DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP007252

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_308550.4 Gene:AgaP_AGAP007252 / 1269896 VectorBaseID:AGAP007252 Length:305 Species:Anopheles gambiae


Alignment Length:243 Identity:89/243 - (36%)
Similarity:124/243 - (51%) Gaps:9/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            ||..|.:|:..||||||.:....|..... ||.|:::..|:|||||||:.:.......|...|..
Mosquito    63 RIVNGYVAQPGQFPYQVAILSTFPTGSGL-CGGSVLTANYVLTAAHCVDVSNGGLVIYGAQDRTV 126

  Fly    96 ---PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA 157
               .:|.|......|.|||:||...:..|||.:|:.......|.|:|:.||.||...|.:..:..
Mosquito   127 NEPSQQRIAFEQSGVRLHPNWNPALIRYDIATIRVVSPVTFSDRIQPVTLPRLSDVGNDFAGLIG 191

  Fly   158 IASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYAN-IKPTNICMDTTGGKSTCTGDSGGPL- 220
            ..||:||.:|.....|..||||...:::|..|...:.. ::|.|||:....|:..|.||||||| 
Mosquito   192 TVSGFGRFSDSIQEASAILRYVNNPIQTNLACSVRFPGVVQPENICLSGDSGRGACQGDSGGPLT 256

  Fly   221 VYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGV 268
            :..|   ...:.:||.|:|...||...:||||.|.|::|.||||.|.|
Mosquito   257 IVRD---GTTVQLGVVSFGLALGCELNWPSVFARTTSFLAWIGENSDV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/235 (35%)
AgaP_AGAP007252XP_308550.4 Tryp_SPc 63..295 CDD:214473 83/235 (35%)
Tryp_SPc 64..295 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.