DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP007251

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_308541.4 Gene:AgaP_AGAP007251 / 1269887 VectorBaseID:AGAP007251 Length:313 Species:Anopheles gambiae


Alignment Length:249 Identity:88/249 - (35%)
Similarity:129/249 - (51%) Gaps:15/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HGI--GGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV-----EKAVA 83
            ||.  .|||..|..||..||||| .|.:.|.......||.::::..::|||||||     .||..
Mosquito    59 HGTHPSGRITNGLEARVGQFPYQ-ALLLTEFGMFTIMCGGTVLTPNFILTAAHCVMLDQTTKATG 122

  Fly    84 ITYYLGGVLRL---APRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGL 145
            ....||...|:   :.:|.||.....:.:||.:...:...|:|:|||.........::|:|||..
Mosquito   123 GMAILGAHNRMVVESTQQRIRFATSGIIVHPSYTATNFRFDVAMVRLNAPLRFNSYVQPVRLPAR 187

  Fly   146 SSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYAN--IKPTNICMDTTGG 208
            :..| .:|.:....||:||.||:...:...|||....:.||..|...:.:  ::|.|||:...||
Mosquito   188 TDQR-LFDGIIGTVSGFGRTNDKDGILPSILRYTINTILSNGACAARWGSLLVEPHNICLSGDGG 251

  Fly   209 KSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            :|.|.|||||||...: .......:||||:|..:|||.|.|:|:.|::.:||||
Mosquito   252 RSACVGDSGGPLTIEE-WGGITYQVGVTSFGSGNGCTDGMPTVYGRVSYFLDWI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/240 (35%)
AgaP_AGAP007251XP_308541.4 Tryp_SPc 66..304 CDD:214473 83/240 (35%)
Tryp_SPc 67..307 CDD:238113 84/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.