DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CLIPB7

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_307910.4 Gene:CLIPB7 / 1269288 VectorBaseID:AGAP002270 Length:401 Species:Anopheles gambiae


Alignment Length:312 Identity:88/312 - (28%)
Similarity:132/312 - (42%) Gaps:78/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVQGRSISCL--------DMGHGIGGRIAG---------GELARANQFPYQVGLSIE-EPNDMYC 59
            ||.|.:|..|        :...|:...:.|         ||||:...||:.|.:... :..:..|
Mosquito   104 LVDGETIDGLVENRFSTPEEKRGLLPEVCGVDTYRGPIRGELAQLFHFPWNVLIQHRTKDGEHRC 168

  Fly    60 WCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQ-------- 116
            .||.|||||||:||||.|: ..:..|:.:..| |:.          |::|..|.:|.        
Mosquito   169 HCGGSLISDRYVLTAARCI-MGIKKTWTIVSV-RVG----------ELNLQTDPDCDDSTAGVTE 221

  Fly   117 -------------------------SLENDIALVRLPEDALLCDSIRPIRLP-------GLSSSR 149
                                     :::.||||:||.......:|:.||.||       |.|:.:
Mosquito   222 CASPVEDIPIEKITVPSNYTGTGSPAVKQDIALLRLARRVEFSESVAPICLPLNTSNWVGYSTEQ 286

  Fly   150 NSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC--EYSYANIKPTNICMDTTGGKSTC 212
            :...|    .||||:..|.:....:...||...| :.|.|  .|.:|:|....||......::||
Mosquito   287 DGSFY----ESGWGKTPDAAAGGDNKWNYVSVGV-AREVCRDRYPHASIDGEQICAMPRSEQNTC 346

  Fly   213 TGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGE 264
            .||:||||:|......|..|:||.|:.|:.... |.|:|:|.:..:.|||.|
Mosquito   347 RGDTGGPLMYQSGTDGAWYLMGVGSFRKQCAIV-GEPAVYTNVATFTDWIVE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/282 (28%)
CLIPB7XP_307910.4 CLIP 31..85 CDD:288855
Tryp_SPc 151..398 CDD:238113 77/265 (29%)
Tryp_SPc 151..395 CDD:214473 74/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.