DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CLIPB1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_307756.2 Gene:CLIPB1 / 1269160 VectorBaseID:AGAP003251 Length:372 Species:Anopheles gambiae


Alignment Length:265 Identity:88/265 - (33%)
Similarity:134/265 - (50%) Gaps:44/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCW-CGASLISDRYLLTAAHCVEKAVAITYYLGGVLRL 94
            ||.||.::..:.:|:...:...:.::.|.: ||..||.::|:||||||:| .|..|:.:..| ||
Mosquito   114 RIVGGGVSPIDGYPWLTRIQYYKGSNRYGFHCGGVLIHNQYVLTAAHCIE-GVPSTWIVYQV-RL 176

  Fly    95 AP------------------RQLIRSTNPEVHLHPDWNCQSLE--NDIALVRLPEDALLCDSIRP 139
            ..                  |.::  .|..| :|||:..|:..  |||||::|.|.....|.|||
Mosquito   177 GEFDTTTTIDCVEDDCADPVRDVL--INAYV-VHPDYYKQNGADYNDIALLQLSETVEFTDFIRP 238

  Fly   140 IRLPGLSSSR-----NSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIK-- 197
            |.||....||     ..|    |..:|||: .:.||:.:..|......|: ||.|..::::|:  
Mosquito   239 ICLPTSEESRTVNLTGKY----ATVAGWGQ-TENSTSSTKKLHLRVPVVD-NEVCADAFSSIRLE 297

  Fly   198 --PTNICMDTTGGKSTCTGDSGGPLV-YSDPVQNAD--ILIGVTSYGKKSGCTKGYPSVFTRITA 257
              ||.:|.....||.:|.|||||||: |.|...:..  .|||:.|:|.:...|.|.|.|:||::.
Mosquito   298 IIPTQLCAGGEKGKDSCRGDSGGPLMRYGDGRSSTKSWYLIGLVSFGLEQCGTDGVPGVYTRMSE 362

  Fly   258 YLDWI 262
            |:||:
Mosquito   363 YMDWV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 87/263 (33%)
CLIPB1XP_307756.2 CLIP 32..85 CDD:288855
Tryp_SPc 114..367 CDD:214473 87/263 (33%)
Tryp_SPc 115..367 CDD:238113 86/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.