DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP012692

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_307636.4 Gene:AgaP_AGAP012692 / 1269055 VectorBaseID:AGAP012692 Length:277 Species:Anopheles gambiae


Alignment Length:252 Identity:77/252 - (30%)
Similarity:113/252 - (44%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEK---AVAITYY---- 87
            |||..|:.|....:||.|.|.:....    .||||:|:..::.|||||:.|   ..:||.|    
Mosquito    50 GRIVNGKNANIASYPYIVRLRVNSAG----VCGASIITYTHVFTAAHCLYKNQNPASITLYGGST 110

  Fly    88 ---LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSR 149
               .|||:..|.:.:|         ||.:|.::...|..:|::........:|.||.|.......
Mosquito   111 SQTSGGVVFFASKVII---------HPYYNPETHNYDAGIVQIKNSFQGYKNIAPIALQDAEVPS 166

  Fly   150 NSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYAN-IKPTNICMDTTGGKSTCT 213
            ::..|    |:|||..|.:.....|||:|....|.|.:.|..:::. ..|..||.........|.
Mosquito   167 DTTCY----AAGWGYNNYDRKTSPDNLQYATLQVISPQQCSAAWSGYATPQFICAQQNNNGDVCN 227

  Fly   214 GDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRI--TAYLDWIGEVSGV 268
            ||||||.|.:|.      |.|.||||..: |....||.||::  .|..::|..|:|:
Mosquito   228 GDSGGPFVCNDK------LTGATSYGGVA-CRGKLPSAFTKVFAPAIREFIRSVAGI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/243 (30%)
AgaP_AGAP012692XP_307636.4 Tryp_SPc 51..264 CDD:214473 72/236 (31%)
Tryp_SPc 52..274 CDD:238113 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.