DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and St14

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:117/262 - (44%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITY--------Y 87
            |:.||..|...::|:||.|.......:   |||||||..:|::||||.:......|        :
  Rat   614 RVVGGTNADEGEWPWQVSLHALGQGHL---CGASLISPDWLVSAAHCFQDETIFKYSDHTMWTAF 675

  Fly    88 LG----------GVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL 142
            ||          ||.....:::|        .||.:|..:.:.||||:.|.:.|.....:|||.|
  Rat   676 LGLLDQSKRSASGVQEHKLKRII--------THPSFNDFTFDYDIALLELEKPAEYSTVVRPICL 732

  Fly   143 PGLSSSRNSYDYVPAIA---SGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMD 204
            |.     |::.:....|   :|||...:..|......:...|.:......|.....|.|..:|:.
  Rat   733 PD-----NTHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEELLPQQITPRMMCVG 792

  Fly   205 -TTGGKSTCTGDSGGPLVYSDPVQNADIL-IGVTSYGKKSGCT-KGYPSVFTRITAYLDWIGEVS 266
             .:||..:|.|||||||  |...::..|. .||.|:|:  ||. :..|.|:|||....|||.|.:
  Rat   793 FLSGGVDSCQGDSGGPL--SSVEKDGRIFQAGVVSWGE--GCAQRNKPGVYTRIPEVRDWIKEQT 853

  Fly   267 GV 268
            ||
  Rat   854 GV 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/254 (30%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 76/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.