DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CTRC

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:177 Identity:57/177 - (32%)
Similarity:78/177 - (44%) Gaps:34/177 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW---CGASLIS 67
            |.|...:|....|.........:..|:.|||.||.:.:|:|:.|...: ||  .|   ||.:||:
Human     4 ITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK-ND--TWRHTCGGTLIA 65

  Fly    68 DRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEV--------------HLHPDWNCQSL 118
            ..::||||||:..  ..||          |..:...|.||              |:|..||...|
Human    66 SNFVLTAAHCISN--TRTY----------RVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLL 118

  Fly   119 ENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRM 165
            .|||||::|.|...|.|:|:...||. ..|....|| |...:||||:
Human   119 RNDIALIKLAEHVELSDTIQVACLPE-KDSLLPKDY-PCYVTGWGRL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 53/152 (35%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 52/150 (35%)
Tryp_SPc 30..>173 CDD:238113 52/151 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.