DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Ctrl

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:271 Identity:81/271 - (29%)
Similarity:126/271 - (46%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDR 69
            |:.:.||....|..:..:........||..||.|....:|:||.|   :.|..:.:||.||||..
Mouse     7 TLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSL---QDNTGFHFCGGSLISPN 68

  Fly    70 YLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPE---------VHLHPDWNCQSLENDIALV 125
            :::|||||..........||        :..||:|.|         ...||:||..::.||:.|:
Mouse    69 WVVTAAHCQVTPGRHFVVLG--------EYDRSSNAEPVQVLSIARAITHPNWNANTMNNDLTLL 125

  Fly   126 RLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNL-RYVYRFVESNEDC 189
            :|...|.....:.|:.|...:.:..|  .:..:.:||||::.........| :.|...|..|:..
Mouse   126 KLASPARYTAQVSPVCLASTNEALPS--GLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCR 188

  Fly   190 EYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTR 254
            :|..|.|....||...:|. |:|.||||||||...  .|..:|||:.|:|.|: |....|:::||
Mouse   189 QYWGARITDAMICAGGSGA-SSCQGDSGGPLVCQK--GNTWVLIGIVSWGTKN-CNIQAPAMYTR 249

  Fly   255 ITAYLDWIGEV 265
            ::.:..||.:|
Mouse   250 VSKFSTWINQV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/240 (31%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 74/240 (31%)
Tryp_SPc 34..260 CDD:238113 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.