DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:250 Identity:81/250 - (32%)
Similarity:116/250 - (46%) Gaps:43/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGELARANQFPYQVGLSIEEPNDMYCW-----CGASLISDRYLLTAAHCV---EKAVAITYYLGG 90
            ||:.:.|..:|:|..|         .|     ||.|||:..::|:||||.   .....:|..||.
Zfish   310 GGQNSSAVHWPWQASL---------YWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTVILGP 365

  Fly    91 VL--RLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYD 153
            ..  :..|.::.||....:. ||.:|..:.:||||||||.......|||||:.|....|..|| |
Zfish   366 KTQNKYDPSRISRSVKAVIK-HPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNS-D 428

  Fly   154 YVPAIASGWGRMNDESTAISDNLRYVYRFVE----SNEDCE--YSYANIKPTNICMD-TTGGKST 211
            ....|.: |..::|.....|..   :::.||    .|..|.  |...:|....||.. ...||..
Zfish   429 TESWITT-WRNISDGVPLPSPK---IFQEVEVPVIGNRQCNCLYGVGSITDNMICAGLLKEGKDL 489

  Fly   212 CTGDSGGPLVYSDP---VQNADILIGVTSYGKKSGCTKG-YPSVFTRITAYLDWI 262
            |.||||||:|.:..   ||:     |:.|:|  |||.:. :|.|:||::.|.:||
Zfish   490 CQGDSGGPMVSNQSSVWVQS-----GIVSFG--SGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/248 (32%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 79/248 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.