DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk5

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:247 Identity:66/247 - (26%)
Similarity:110/247 - (44%) Gaps:30/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            ||..|.....:..|:| |..:..||.:|  |||.||:.::|||||||.:....|..   |...::
  Rat    67 RIVNGSDCPKDTQPWQ-GALLLGPNKLY--CGAVLINPQWLLTAAHCRKPVFRIRL---GHHSMS 125

  Fly    96 P-----RQLIRSTN--PEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYD 153
            |     :|:.:...  |    ||.::.....||:.|:::........|::|:.:    :|....:
  Rat   126 PVYESGQQMFQGIKSIP----HPGYSHPGHSNDLMLIKMNRKIRASHSVKPVEI----TSDCPKE 182

  Fly   154 YVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMDTTGGKSTCTGDSG 217
            ....:.||||..:.........|:.:...|.|.|.|:.|| ..|..|..|.....|:.:|.||||
  Rat   183 GTRCMVSGWGTTSSSHNNFPKVLQCLDITVLSEERCKNSYPGQIDKTMFCAGDEAGRDSCQGDSG 247

  Fly   218 GPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVH 269
            ||::.:..:|      |:.|:|.........|.|:|.:..::.||.:.  :|
  Rat   248 GPVICNGKLQ------GLVSWGDFPCAQPNRPGVYTNLCEFVPWIKDT--IH 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 63/238 (26%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.