DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG42694

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:283 Identity:63/283 - (22%)
Similarity:121/283 - (42%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRS-ISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLI 66
            :.|:..:||:|...:| ::...:....|..|:...:.:..| | |.|......|..:..|..|||
  Fly     1 MQTLFAWLLMLTVLQSHVNSKFLDDYCGAPISNQSITKLRQ-P-QAGWLAHISNGTHVLCSGSLI 63

  Fly    67 SDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLH-------PDWNCQSLENDIAL 124
            |.:::|:||.|::....:...||          :.:.....|.:       |..:.:.|:.||.|
  Fly    64 SKQFVLSAAQCIDVHGKLFVQLG----------VSNATKSPHWYTVSNVVIPSHSGKRLQRDIGL 118

  Fly   125 VRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI----ASGW-GRMNDESTAISDNLRYVYRFVE 184
            ::|.:.....|.:.||   .::.:.|:.|.|..:    .|.| .:..:..|.:...|        
  Fly   119 LKLSQSVDYNDFVYPI---CIALNTNTLDMVKILQNFTTSAWLSKNKNPQTIVLSQL-------- 172

  Fly   185 SNEDCEYSYA-NIKPTNICMDTTGGKSTCTGDSGGPLVYSDP-VQNADI----LIGVTSY-GKKS 242
            |.:.|:.:.: |:.|..||..:....::|..|||..|  :.| :|.::|    |.|:..| ..:|
  Fly   173 SRDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSAL--TQPIIQGSNIVREMLFGIRGYVNGRS 235

  Fly   243 GCTKGYPSVFTRITAYLDWIGEV 265
            .|::  |:::..:...:.||..|
  Fly   236 WCSE--PAIYIDVAECVGWIETV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 54/249 (22%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 51/234 (22%)
Tryp_SPc 46..253 CDD:214473 49/231 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.