DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC101732176

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:266 Identity:88/266 - (33%)
Similarity:127/266 - (47%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SISCLDMGHG--IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEK 80
            |:.|::.|..  :..||.||..|.|..:|:|:.|.......:|. ||.|:|:..:::||||||..
 Frog   261 SLRCINCGLSTKVDNRIVGGTFALAGDWPWQISLMKLVGTSLYL-CGGSIITPYWIVTAAHCVYG 324

  Fly    81 -----------AVAIT---YYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDA 131
                       |.::|   ||..|.  |..|.||         ||.::..:...||||::|....
 Frog   325 YTSSPSIFKVFAGSLTLSNYYSAGY--LVDRVLI---------HPSYSPNTQNYDIALLKLKTAL 378

  Fly   132 LLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYS--YA 194
            :...::||:.||.:...  ..|..|...|||| ...|:.:||.:|:.....:.|:..|..:  |.
 Frog   379 VFSTNLRPVCLPNVGMP--WADGQPCWISGWG-TTSEAGSISTSLKAASVPIISSATCNLAPVYG 440

  Fly   195 N-IKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGY-PSVFTRIT 256
            . |.||.||.. ..||..||.||||||||  ....:...|:|.||:|  .||.:.| |.|:..||
 Frog   441 GVISPTMICAGYLGGGTDTCQGDSGGPLV--TKTNSLWWLVGDTSWG--YGCARAYKPGVYGNIT 501

  Fly   257 AYLDWI 262
            .:|:||
 Frog   502 VFLEWI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/249 (33%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 3/9 (33%)
Tryp_SPc 277..510 CDD:238113 84/250 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.