DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC101732100

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_031749505.1 Gene:LOC101732100 / 101732100 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:275 Identity:86/275 - (31%)
Similarity:131/275 - (47%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW------CGASLISDRYLLTA 74
            |:|::       |..||.||:.|:..::|:|..|          |      ||.:|:|.:::::|
 Frog    28 GKSVA-------ISDRIVGGQDAKKGKYPWQALL----------WCPGVYRCGGTLVSSKWVVSA 75

  Fly    75 AHCVEK--AVAITYYLGGVLRLAPRQLIRSTNPE-------VHLHPDWNCQSLENDIALVRLPED 130
            |||:.:  |..:...||.      .:|..:.|.|       :::||::|...:.|||.|..|.:.
 Frog    76 AHCLSRSNASCLAVILGA------NKLSGNENEEMAVSVKNIYIHPNYNDTDITNDIGLAELTQA 134

  Fly   131 ALLCDSIRPIRLPGLSSSRNSYDYVPAIA---SGWGRMNDESTAISDN-LRYVYRFVESNEDCEY 191
            ......:.|:.||..|:..|     |..:   :||| :.:.:|::|.| |:.|...:.|.|.|..
 Frog   135 VSFTSYVIPVCLPTASTIFN-----PGQSCWVTGWG-VTEFNTSLSPNTLQEVQMRILSAEQCRS 193

  Fly   192 SY------ANIKPTNIC-MDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYP 249
            .|      ..|....|| .|..|||.:|.||||||||.|  ......|:||.|:|...|.| .||
 Frog   194 YYDPNITGVYITDQMICARDILGGKDSCQGDSGGPLVCS--YGGNFYLVGVVSFGIGCGDT-AYP 255

  Fly   250 SVFTRITAYLDWIGE 264
            .|:|.:.||.||||:
 Frog   256 GVYTYVPAYRDWIGK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 80/256 (31%)
LOC101732100XP_031749505.1 Tryp_SPc 37..268 CDD:238113 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.