DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and si:ch73-182e20.4

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_009296334.2 Gene:si:ch73-182e20.4 / 100535157 ZFINID:ZDB-GENE-131127-155 Length:341 Species:Danio rerio


Alignment Length:304 Identity:96/304 - (31%)
Similarity:143/304 - (47%) Gaps:56/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STILVFLLILVQGRSISCLDM----GHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGAS 64
            :::.:.||:.|:..|:|.|.:    ...:..||.||..:....:|:.|.|.. ..|.:   ||.|
Zfish    39 TSVTLLLLMCVRADSLSNLQVCGRPNPQLNPRIVGGLNSTEGAWPWMVSLRY-YGNHI---CGGS 99

  Fly    65 LISDRYLLTAAHCVEKAVA-ITYYLGGVLRLAP--RQLIRSTNPEVHLHPDWNCQSLENDIALVR 126
            ||::.::|||||||....: :..|||...|.|.  .::.|:.: .:..||.:|..:.:|||||::
Zfish   100 LINNEWVLTAAHCVNLTRSNMLVYLGKWRRYAADVNEITRTVS-NIIPHPSYNSTTYDNDIALLQ 163

  Fly   127 LPEDALLCDSIRPIRL--------PGLSSSRNSYDYVPAIASGWGRMNDES-------TAIS--- 173
            |.......|.|:|:.|        ||..|          .|:||||:....       |.:|   
Zfish   164 LSSTVHYSDYIKPVCLADEQSNFPPGTRS----------WATGWGRIGVSGKGGIRGRTTVSVPL 218

  Fly   174 ---DNLRYVYRFVESNEDC-EYSYANIKPTNICMDT-TGGKSTCTGDSGGPLVYSDPVQNADILI 233
               ..|:.|...|.||.|| ...:..|.|..||..| :|||:|.:||||||||...  .:..:..
Zfish   219 PPPGILQEVKLKVYSNADCNSICHGRINPNMICAGTRSGGKATFSGDSGGPLVSKQ--CSVWVQA 281

  Fly   234 GVTSYGKKSGCTK-GYPSVFTRITAYLDWI-----GEVSG-VHY 270
            ||.|:|  .||.: ..|.||.|::.|..||     |.:.| ||:
Zfish   282 GVVSHG--YGCAQPNLPEVFIRVSEYKQWITAAVGGNLPGFVHF 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 84/257 (33%)
si:ch73-182e20.4XP_009296334.2 Tryp_SPc 71..309 CDD:238113 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.