DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC100535114

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_009296342.3 Gene:LOC100535114 / 100535114 -ID:- Length:329 Species:Danio rerio


Alignment Length:292 Identity:93/292 - (31%)
Similarity:138/292 - (47%) Gaps:37/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILVQGRSIS----CLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASL 65
            |.::.||::....|:|    |.........||.||..|....:|:.|.|.....:    :||.||
Zfish     5 TCVILLLVMCVRDSLSQPDVCGRPNPNFNPRIVGGVNATEGSWPWMVSLRKSGVH----FCGGSL 65

  Fly    66 ISDRYLLTAAHCV--EKAVAITYYLGGVLRLAPRQ-LIRSTNPEVHLHPDWNCQSLENDIALVRL 127
            |:::::||||||:  :...::..|||...|....| .|..|..::..||.:|.::.:|||||::|
Zfish    66 INNQWVLTAAHCISGKTTSSMHVYLGKWRRYETDQNEITRTVIDIIPHPSYNNRTSDNDIALLQL 130

  Fly   128 PEDALLCDSIRPIRLPGLSSS--RNSYDYVPAIASGWGRMNDEST-AISDN------------LR 177
            .........|:||.|...:|:  |.:..:|    :||||:....| .||..            |:
Zfish   131 SATVQYTVYIKPICLADQNSNFPRGTRSWV----TGWGRIGVSGTGGISGRTTVSVPLPAPGILQ 191

  Fly   178 YVYRFVESNEDC-EYSYANIKPTNICMDT-TGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGK 240
            .|...|.|||.| :.....|.|..||..| :|||.|..|||||||:...  .:..:..||.|:| 
Zfish   192 EVELQVYSNEKCSKRCQGPITPNMICAGTRSGGKGTFYGDSGGPLMSKQ--CSVWVQAGVVSHG- 253

  Fly   241 KSGCTK-GYPSVFTRITAYLDWIGEVSGVHYP 271
             .||.: ..|.||.|::.|..||.:..|.:.|
Zfish   254 -YGCAQPKIPGVFIRVSEYKQWITDNIGGNLP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/251 (33%)
LOC100535114XP_009296342.3 Tryp_SPc 36..278 CDD:238113 84/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.