DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and ovch2

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:326 Identity:86/326 - (26%)
Similarity:129/326 - (39%) Gaps:104/326 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCL---DMGHGIG-----------------GRIAGGELARANQFPYQV 47
            :.:||:.|.:      ||||   |.|...|                 .||.||..::..|.|:.|
 Frog    21 VRSILLSLAV------ISCLGEEDPGSIRGARCGESPLGSARDLNYLSRIVGGRESKKGQHPWTV 79

  Fly    48 GLSIEEPNDMYCWCGASLISDRYLLTAAHC-VEKAVA--ITYYLGGVLRLAPRQLIRSTNP---- 105
            .|   :.|..: :||..|:|.|::|||:|| :::.|.  |..:.|..     .|.|:....    
 Frog    80 SL---KRNGKH-FCGGILVSRRHVLTASHCLLDRNVKSYIRVFFGEY-----DQTIKEDTEQTFK 135

  Fly   106 --EVHLHPDWN-CQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYD-YVP---AIASGWG 163
              |:..|||:| .|.:..|:|::.|.......|:|:|..:|      |..| :.|   .:..|||
 Frog   136 VIEIFKHPDFNYTQPMNYDVAVLVLDGAVTFDDNIQPACMP------NPDDVFEPGDLCVTLGWG 194

  Fly   164 RMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDT-------------------TGGK 209
            .:. |:..:...|:.|.          ....|:   :||:|.                   .|||
 Frog   195 HLT-ENGILPGVLQEVL----------LPLVNL---SICLDVMATLKGAVVSSKIVCAGFPEGGK 245

  Fly   210 STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC-------------TKGYPSVFTRITAYLDW 261
            ..|.|||||||: ........:|.|:||:|  .||             .||.|.:||.|...|.|
 Frog   246 DACQGDSGGPLL-CQRRHGTWVLHGLTSWG--MGCGRSWKNNMFLPANRKGSPGIFTDIQKLLGW 307

  Fly   262 I 262
            :
 Frog   308 V 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/276 (27%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 75/277 (27%)
CUB 330..436 CDD:238001
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.