DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC100495222

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_031749236.1 Gene:LOC100495222 / 100495222 -ID:- Length:755 Species:Xenopus tropicalis


Alignment Length:253 Identity:76/253 - (30%)
Similarity:116/253 - (45%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYY---LG 89
            :..||.||..|....:|:|..|..:..:    .||.|:||:::::|||||.|.::..:.|   ||
 Frog   427 VSSRIVGGTAAMNGAWPWQASLQYQYSH----ICGGSVISNKWIMTAAHCFENSLTTSLYRVRLG 487

  Fly    90 GV-LRL-APRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSY 152
            .. |.| :|.:.|.|.. .:.::..:|.|:...|||||.|.........|.|:.:|  |||.|..
 Frog   488 AYQLSLSSPNEFISSVK-SITVNSQYNSQTNFGDIALVELSSTITYTTFILPVCVP--SSSANFT 549

  Fly   153 DYVPAIASGWGRMN-DESTAISDNLRYVYRFVESNEDCEYSYAN----------IKPTNICMD-T 205
            ..:....:|||.:. .........|:.|...:.|.:.||..|..          ::...||.. .
 Frog   550 AGMECWVTGWGNIGWGAKLPYPQTLQQVMTPLISRDSCEQMYHTSTGVSSSVTIVRVDQICAGYA 614

  Fly   206 TGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWI 262
            .|.|.:|.||||||||.:  ||.....:|:.|:|:  ||. ...|.|:|.:..|..|:
 Frog   615 AGQKDSCQGDSGGPLVCN--VQGVWYQVGIVSWGE--GCALANSPGVYTLVPNYRSWL 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/248 (30%)
LOC100495222XP_031749236.1 Tryp_SPc 41..279 CDD:238113
Tryp_SPc 431..670 CDD:238113 75/249 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.