DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and prss8l.5 loc108703873

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002939739.1 Gene:prss8l.5 loc108703873 / 100494289 XenbaseID:XB-GENE-22167980 Length:353 Species:Xenopus tropicalis


Alignment Length:255 Identity:76/255 - (29%)
Similarity:124/255 - (48%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVL 92
            :..||.||:.::...:|:||.:   ..|| :.:||.|||:.:::::|:||..:....::|   .:
 Frog    32 VSTRIMGGQDSQQGMWPWQVNI---RSND-FSFCGGSLITSKWVISASHCFNRTNPPSFY---TV 89

  Fly    93 RLAPRQLIRSTNPEVHL-------HPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRN 150
            .|...||..:...|:.:       ||::......:||.||.|..|....:.|:|:.||  |:..|
 Frog    90 YLGSYQLTGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYIQPVCLP--SAGVN 152

  Fly   151 SYDYVPAIASGWGRM-NDESTAISDNLRYVYRFVESNEDCE-----------YSYANIKPTNICM 203
            ....:....:|||.: ::.|....:.|:.|...:..|:.|.           .|:|.:.......
 Frog   153 FPTGLQCWVTGWGNIASNVSLRDPNTLQQVAVPLIGNQQCNSILQAPSPLGPSSFAILNDMLCAG 217

  Fly   204 DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWI 262
            ...|||.:|.||||||||.:  ..|...|:||.|:|  .||.: ..|.|:.|:|||||||
 Frog   218 YIDGGKDSCQGDSGGPLVCA--AANQWYLVGVVSFG--DGCGQPNRPGVYVRVTAYLDWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/250 (30%)
prss8l.5 loc108703873XP_002939739.1 Tryp_SPc 35..273 CDD:214473 74/250 (30%)
Tryp_SPc 36..275 CDD:238113 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.