DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and corin

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_004911266.2 Gene:corin / 100492163 XenbaseID:XB-GENE-950958 Length:1123 Species:Xenopus tropicalis


Alignment Length:294 Identity:83/294 - (28%)
Similarity:137/294 - (46%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILVQG------RSISCL----DMGH----GIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCG 62
            :|::|      |.:|.|    |.|.    .:..||.||..:|..::|:|..|..:....:   ||
 Frog   849 LLIKGQPCESRRKVSLLCTKEDCGRRPAARMSKRILGGRTSRPGRWPWQCSLQSDPSGHI---CG 910

  Fly    63 ASLISDRYLLTAAHCVE--KAVAITYYLGGVLRL------APRQLIRSTNPEVHLHPDWNCQSLE 119
            ..||..:::||.|||.|  ::.|:...:.|:..|      |..:|::    ::.|||.:|...::
 Frog   911 CVLIGKKWVLTVAHCFEGRESAAVWKVVFGINNLDHPSDFAQTRLVK----KIILHPRYNRAVVD 971

  Fly   120 NDIALVRLPEDALLCDSIRPIRLP--GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRF 182
            .||::|.|.||......:||:.||  |.....::|.|:    :|||.|.:         :..::.
 Frog   972 YDISIVELNEDITETSYVRPVCLPTKGQLVEPDTYCYI----TGWGHMGN---------KMPFKL 1023

  Fly   183 VE------SNEDCEYSYANIKPTNICMDTTGGKS----TCTGDSGGPLVYSDPVQNADILIGVTS 237
            .|      |.|.|: ||.::|.....|...|.:|    :|.||||||||...| .....|.|:||
 Frog  1024 QEGEVRIISLERCQ-SYFDMKTITSRMLCAGYESGTIDSCMGDSGGPLVCEKP-GGKWTLYGLTS 1086

  Fly   238 YGKKSGCTKGY--PSVFTRITAYLDWIGEVSGVH 269
            :|  |.|....  |.|::.::.:::||.....:|
 Frog  1087 WG--SVCFSKVLGPGVYSNVSHFVEWIERQIYIH 1118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/252 (29%)
corinXP_004911266.2 CRD_corin_1 213..341 CDD:143554
LDLa 351..382 CDD:238060
LDLa 384..418 CDD:238060
LDLa 420..455 CDD:238060
LDLa 465..492 CDD:238060
CRD_corin_2 533..654 CDD:143579
LDLa 659..693 CDD:238060
LDLa 734..768 CDD:238060
Tryp_SPc 883..1114 CDD:238113 74/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.