DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and tmprss9

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:250 Identity:85/250 - (34%)
Similarity:125/250 - (50%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVE--------KAVAITYY 87
            :|.||..:...::|:||.|.:......   |||.|||||:||:||||.:        .|...|.:
 Frog   918 KIVGGSGSVRGEWPWQVSLWLRRKEHK---CGAVLISDRWLLSAAHCFDIYSDPKLWAAYLGTPF 979

  Fly    88 LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLS-----S 147
            |.|| .....::.|     :|.||.:|..:|:||:||:.||......:.||||.||.:|     .
 Frog   980 LNGV-EGRVEKIFR-----IHKHPFYNVYTLDNDVALLELPSPLTYTNLIRPICLPDISHIFPEG 1038

  Fly   148 SRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMD-TTGGKS 210
            :|       ...:||| ...|..|:|..|:.....:..::.|:..| ..|.|..:|.. ..||..
 Frog  1039 TR-------CFITGWG-STKEGGAMSRQLQKASVSIVGDQTCKKFYPIQISPRMLCAGFMQGGVD 1095

  Fly   211 TCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGY-PSVFTRITAYLDWIGE 264
            :|:||:||||...:| .....|.|:||:|  .||.:.| |.|:||||:..:|||:
 Frog  1096 SCSGDAGGPLACREP-SGRWFLAGITSWG--YGCARPYFPGVYTRITSVRNWIGQ 1147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/246 (33%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473
Tryp_SPc 547..774 CDD:238113
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113 82/245 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.