DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC100485347

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002941066.3 Gene:LOC100485347 / 100485347 -ID:- Length:255 Species:Xenopus tropicalis


Alignment Length:270 Identity:85/270 - (31%)
Similarity:122/270 - (45%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW----CGASLISDRY 70
            ||:|::|.....    |    ||.|||....:..|:||.|        |.:    ||..||::.:
 Frog     9 LLLLLRGSEAQT----H----RIIGGEECVPHSQPWQVAL--------YYFSDFICGGVLINEWW 57

  Fly    71 LLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHL-------HPDWNCQSLENDIALVRLP 128
            :||||||.:..:.:  .||...|.:|      |..|.:.       |.|:...:.:|||.|::|.
 Frog    58 VLTAAHCNQSNLQV--LLGAHNRTSP------TGDEQYTYAAKICPHQDFEPVTYDNDIMLLKLA 114

  Fly   129 EDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE--Y 191
            .:|.:...:.||.|.......||    ..:|||||............|:.|.....||.||:  |
 Frog   115 SEADINTWVAPIPLASYLVDDNS----ECLASGWGSTTSPEETYPGELQCVNITTVSNSDCQDYY 175

  Fly   192 SYANIKPTNICM-DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRI 255
            ....|....:|. |..|||.||.||||||||.::.      |.|:||:|.....:...|.||.::
 Frog   176 PRDTITDNMLCAGDVAGGKDTCGGDSGGPLVCNEE------LHGITSWGDLVCGSPDKPGVFAKV 234

  Fly   256 TAYLDWIGEV 265
            :.|:|||.:|
 Frog   235 SNYIDWISDV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/244 (32%)
LOC100485347XP_002941066.3 Tryp_SPc 23..244 CDD:238113 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.