DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC100331291

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_009295692.1 Gene:LOC100331291 / 100331291 -ID:- Length:932 Species:Danio rerio


Alignment Length:254 Identity:76/254 - (29%)
Similarity:127/254 - (50%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITY--------Y 87
            :|.||..|:|..:|:||.|.:|....:   |||||::.|:|::||||.:.:.||.|        |
Zfish   690 KIVGGTDAQAGSWPWQVSLQMERYGHV---CGASLVASRWLVSAAHCFQDSDAIKYSDARSWRAY 751

  Fly    88 LGGVLRL--------APRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPG 144
            :|  :|:        |.||:.|     :.||..::..:.:.||||:.|.......:.::|:.:|.
Zfish   752 MG--MRVMNSVSNAAATRQIRR-----IVLHSQYDQFTSDYDIALLELSAPVFFNELVQPVCVPA 809

  Fly   145 LS---SSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYAN-IKPTNICM-D 204
            .|   :|..|     ...:|||.:.:|. .::..|:.....:.::..|...|.: :.|..:|. :
Zfish   810 PSHVFTSGTS-----CFVTGWGVLTEEG-ELATLLQEATVNIINHNTCNKMYDDAVTPRMLCAGN 868

  Fly   205 TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWI 262
            ..||...|.||||||||..:..:.. .|.|:.|:|:  ||.: ..|.|:||:..:.|||
Zfish   869 IQGGVDACQGDSGGPLVCLERGRRW-FLAGIVSWGE--GCARQNRPGVYTRVIKFTDWI 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/252 (29%)
LOC100331291XP_009295692.1 SEA 136..>220 CDD:307516
CUB 315..415 CDD:238001
CUB 421..528 CDD:238001
LDLa 536..568 CDD:238060
LDLa 606..636 CDD:238060
LDLa 644..679 CDD:238060
Tryp_SPc 691..927 CDD:238113 76/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.