DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and f7l

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:269 Identity:82/269 - (30%)
Similarity:130/269 - (48%) Gaps:50/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV-E 79
            ||.::     .|:|.||..|::....|.|:|   ::.|.:..| .||..:::.::::|||||: .
Zfish   184 GRPVA-----KGVGPRIVKGDVCPKGQCPWQ---ALLEYDGQY-KCGGVILNSQWIITAAHCIWR 239

  Fly    80 KAVAITYYLGGVLRLAPRQLIRSTN---------PEVHLHPDWNCQSLENDIALVRLPEDALLCD 135
            |..|:...:.|       :.||..:         .||.|||.:|..|.::|:||:||.....|..
Zfish   240 KDPALLQVIVG-------EHIRDRDEGTEQMRKVSEVFLHPQYNHSSTDSDVALLRLHRPVTLGP 297

  Fly   136 SIRPIRLP--------GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE-Y 191
            ...|:.||        .|:|.|.|      ..|||||: .:|...|..|:.:.....|:|||. .
Zfish   298 YALPVCLPPPNGTFSRTLASIRMS------TVSGWGRL-AQSGPPSTVLQRLQVPRVSSEDCRAR 355

  Fly   192 SYANIKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKG--YPSVFT 253
            |...:....:|.. ..||:.:|.||||||||  ...:|...|.|:.|:||  ||.:.  | .::|
Zfish   356 SGLTVSRNMLCAGFAEGGRDSCQGDSGGPLV--TRYRNTWFLTGIVSWGK--GCARADVY-GIYT 415

  Fly   254 RITAYLDWI 262
            |::.:::||
Zfish   416 RVSVFVEWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 76/252 (30%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.