DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC100004427

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:293 Identity:81/293 - (27%)
Similarity:128/293 - (43%) Gaps:51/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVF---LLILVQGRSISCLDMGHGIG-----GRIAGGELARANQFPYQVGLSIEEPNDM 57
            |..:|:...   :|:.:.|    ||......|     .:|.||..|....:|:|..::.:.....
Zfish     1 MMFNTVFCVAGAVLLNIAG----CLGQSDVCGRAPLNTKIVGGLNATEGSWPWQASINFKSTGQF 61

  Fly    58 YCWCGASLISDRYLLTAAHCVEK--AVAITYYLGGVLRLAPRQLIRSTNP-EVHLHPDWNCQ-SL 118
            :  |..||||:|::||||.|.::  ...:..|||       |.....:|| |:   |....| |:
Zfish    62 F--CSGSLISERWVLTAASCFQRINVSDVVIYLG-------RLTTNGSNPYEI---PRTVIQVSV 114

  Fly   119 ENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFV 183
            ..|||||:|.......|.|||:.|....|.  ..|...:..:|||..:..:..:||.|:.|...:
Zfish   115 TEDIALVQLSSSVTFTDYIRPVCLAAAGSV--FVDGTESWVTGWGSTSSTNVILSDMLKEVEAPI 177

  Fly   184 ESNEDCEYSYANIKP-TN----ICMDTTG--GKSTCTGDSGGPLVY---SDPVQNADILIGVTSY 238
            .:|.:|    :||.. ||    ||.....  ||:.|..|.|.|||.   |..:|:..::.  |..
Zfish   178 VNNIEC----SNINGITNLDNVICAGFVNETGKAPCWEDFGSPLVTRQGSQWIQSGVVVF--TFC 236

  Fly   239 GKKSGCTKGYPSVFTRITAYLDWIGEVSGVHYP 271
            |:     .|:|:::.|::.|.:||...:....|
Zfish   237 GQ-----NGFPTLYARVSEYEEWIRNYTSSSLP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 71/244 (29%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 71/244 (29%)
Tryp_SPc 36..257 CDD:238113 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.