DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and tmprss3a

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:260 Identity:86/260 - (33%)
Similarity:124/260 - (47%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SISCLDMGH--GIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEK 80
            ::.|:..|.  ....||.||.|:...|||:||.|..:..:    .||.|:|:.|::|||||||..
Zfish   282 ALKCIACGSRPKFSARIVGGNLSAEGQFPWQVSLHFQNEH----LCGGSIITSRWILTAAHCVYG 342

  Fly    81 AVAITYYL--GGVLRLAPRQLIRSTNPE-VHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL 142
            .....|::  .|:..| |...:::...| :..|..:..:.|::||||::|.:.......:.||.|
Zfish   343 IAYPMYWMVYAGLTEL-PLNAVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPICL 406

  Fly   143 PGLSSSRNSYDYVPAIASGWGRMNDESTA-ISDNLRYVYRFVESNEDC---EYSYANIKPTNIC- 202
            |.......  |......||||...|...| :|.:...|.  :.||:.|   |.....:....|| 
Zfish   407 PNFGEQFE--DGKMCWISGWGATEDGGDASVSQHCASVP--LISNKACSQPEVYQGYLTAGMICA 467

  Fly   203 --MDTTGGKSTCTGDSGGPLVYSDPVQNADI--LIGVTSYGKKSGCT-KGYPSVFTRITAYLDWI 262
              :|  ||..:|.|||||||...|    :.|  |:|.||:|:  ||. |..|.|:||||..|.||
Zfish   468 GYLD--GGTDSCQGDSGGPLACED----SSIWKLVGATSWGQ--GCAEKNKPGVYTRITQSLTWI 524

  Fly   263  262
            Zfish   525  524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/243 (34%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 2/9 (22%)
Tryp_SPc 298..525 CDD:238113 83/244 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.