DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Wwtr1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001161753.1 Gene:Wwtr1 / 97064 MGIID:1917649 Length:452 Species:Mus musculus


Alignment Length:432 Identity:87/432 - (20%)
Similarity:136/432 - (31%) Gaps:172/432 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 AFIRE------TREQSEPSSGNSDGE-----WEHVEA----------TNAGETS--AQPH----- 238
            :|.:|      :|:.|..|||...|.     .:||.:          |.||...  ||.|     
Mouse   108 SFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGGPAQQHAHLRQ 172

  Fly   239 -PFPTGGHDALPAGWEERQDANGRTYYVNHTARTTQWDRP-TVLN---SHSSQSTDDQLASDFQR 298
             .:.......||.|||....|.|:.|::||..:.|.|..| .|:|   :|.:             
Mouse   173 QSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKVMNQPLNHVN------------- 224

  Fly   299 RFHISVDDTESGRSADSISHNSIEDNNNAAGLAYTPKTAATSSAPPNTPTNNNGILAQIAMQYRA 363
             .|.|:..|...:.:.::|..::..|:.      ..:..|||.:|.|.||.|             
Mouse   225 -LHPSITSTSVPQRSMAVSQPNLAMNHQ------HQQVVATSLSPQNHPTQN------------- 269

  Fly   364 EEDQDPTVDHTSFVYNSLRHPVAHRQPEISATSLQNDLRPVREAPGVPDIAITNPFTRRAAGNMA 428
                                     ||    |.|.:          ||:...|.           
Mouse   270 -------------------------QP----TGLMS----------VPNALTTQ----------- 284

  Fly   429 GGAGWQQERRRQQMQLHIQQHQQRQQQQQQNRILLDVDHRQQEPQHRGQRHQQQHRPSNEDTDHT 493
                 ||::::.::| .||..::|.:.:|:..:..:....:|.|.                  .|
Mouse   285 -----QQQQQKLRLQ-RIQMERERIRMRQEELMRQEAALCRQLPM------------------ET 325

  Fly   494 DSHNPSDISAPSTRRNSEEDNAAVP--------PMEQNT------GGEEEPLPPRWSMQVAPNGR 544
            ::..|.:..|.||...|..::::.|        ..||:|      |....|..|.          
Mouse   326 ETMAPVNTPAMSTDMRSVTNSSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPE---------- 380

  Fly   545 TFFIDHASRRTTWIDPRNGRASPM---PNQTRRVEDDLGPLP 583
                |..|.........|...:||   |.|| |..|.|..||
Mouse   381 ----DFLSNMDEMDTGENSGQTPMTVNPQQT-RFPDFLDCLP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999 0/1 (0%)
WW 248..277 CDD:278809 12/28 (43%)
WW 531..560 CDD:278809 3/28 (11%)
WW 581..613 CDD:197736 2/3 (67%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
Wwtr1NP_001161753.1 WW 182..213 CDD:197736 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.