DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and UBE3B

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_569733.2 Gene:UBE3B / 89910 HGNCID:13478 Length:1068 Species:Homo sapiens


Alignment Length:429 Identity:137/429 - (31%)
Similarity:213/429 - (49%) Gaps:51/429 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 QAVPYSRDYKQKYEYFKSHIRK----------PTNVPNKFEIRIRRTSILEDSYRIISSVTKTDL 675
            |.:|:...:|.:...|::.:.|          .:..|:...|.|||:.:|||.|..:..::: ..
Human   642 QYIPHVIPHKNRVLLFRTMVTKEKEKLGLVETSSASPHVTHITIRRSRMLEDGYEQLRQLSQ-HA 705

  Fly   676 LKTKLWVEFEG-----ETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCN 735
            :|..:.|:|..     |.|:|..|:.:|:...:.|.:|:|...||:.::.|.....  :.:...:
Human   706 MKGVIRVKFVNDLGVDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYP--SPTSYIH 768

  Fly   736 EEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMML-------QKPIDLKDMESVDTEYYNSLM 793
            |.:|..|:|:|::.|.|||.|.::|..|...|...:|       ...:|  ::.|:|:|:|.:|.
Human   769 ENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLGHHHSVFYSSVD--ELPSLDSEFYKNLT 831

  Fly   794 WIKENDPRI--LELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQM 856
            .||..|..|  |.||...||||.||...|||.|||..|.||||||..||.|:..:|...::|.|.
Human   832 SIKRYDGDITDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQT 896

  Fly   857 SSFLDGFGSIIPLNLIKIFDEHELELLMCGIQ-NIDVKDWRENTLYKGDYHMNHIIIQWFWRAVL 920
            ::.:.||.|||....|::|...||:.|:.|.. .||::|.:::|:|.|.:|.:|.:|.|.|..:.
Human   897 AALISGFRSIIKPEWIRMFSTPELQRLISGDNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDILA 961

  Fly   921 S-FSNEMRSRLLQFVTGTSRVPMNGFKEL--------------------YGSNGPQMFTIEKWGT 964
            | |:.:.|:..|:|||..||.|:.||..|                    .||.....|||.|...
Human   962 SDFTPDERAMFLKFVTSCSRPPLLGFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKREP 1026

  Fly   965 PNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            ....|.:.||||.|.||.|.....|::||..||..:.||
Human  1027 GGRLPTSSTCFNLLKLPNYSKKSVLREKLRYAISMNTGF 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 129/388 (33%)
HECTc 674..1003 CDD:214523 121/364 (33%)
UBE3BNP_569733.2 HECTc 682..1066 CDD:238033 131/389 (34%)
HECTc 707..1065 CDD:214523 121/361 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.