DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and UFD4

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_012915.3 Gene:UFD4 / 853859 SGDID:S000001493 Length:1483 Species:Saccharomyces cerevisiae


Alignment Length:404 Identity:107/404 - (26%)
Similarity:185/404 - (45%) Gaps:79/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   651 EIRIRRTSILEDSYRIISSV-TKTDLLKTKLWVEFEGETG------LDYGGLAREWFYLLSKEMF 708
            ::||.|.:|.....:|:|.. :..|:|:    :|::.|.|      |::..:..::|...|..|:
Yeast  1102 KLRISRKTIFATGLKILSKYGSSPDVLE----IEYQEEAGTGLGPTLEFYSVVSKYFARKSLNMW 1162

  Fly   709 N----PYYGLFEYSAMDNY--TL----QINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFF 763
            .    .|....:....|:|  ||    .:|..|.  ||:.:..|.::|.....::...::||..|
Yeast  1163 RCNSYSYRSEMDVDTTDDYITTLLFPEPLNPFSN--NEKVIELFGYLGTFVARSLLDNRILDFRF 1225

  Fly   764 IRPFYKMMLQK--------PIDLKD----MESVDTEYYNSLMWIKEN--DPRILE---LTFCL-- 809
            .:.|::::.:.        |.|::.    :|.||.....||.:|..|  |...||   |||.:  
Yeast  1226 SKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVANKDDNMTLESLSLTFTVPG 1290

  Fly   810 DEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKI 874
            ::|:       ||.|||.|..:.:.|.:|||..||:......:::|:.:|::||.        |:
Yeast  1291 NDDI-------ELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFS--------KV 1340

  Fly   875 FDEHELELLMCGIQNIDV-----KDWRENTLY-----KGDYHMNHIIIQWFWRAVLSFSNEMRSR 929
            | .:|..|::...:.:|:     :||...|||     :..|.|:..||..|...:.:|....|..
Yeast  1341 F-SYERMLILFPDELVDIFGRVEEDWSMATLYTNLNAEHGYTMDSSIIHDFISIISAFGKHERRL 1404

  Fly   930 LLQFVTGTSRVPMNGFKELYGSNGPQMFTI-----EKWGTPNNF-PRAHTCFNRLDLPPYEGYLQ 988
            .|||:||:.::|:.|||.|    .|: ||:     |...|.:.: |...||.|.|.||.|.....
Yeast  1405 FLQFLTGSPKLPIGGFKSL----NPK-FTVVLKHAEDGLTADEYLPSVMTCANYLKLPKYTSKDI 1464

  Fly   989 LKDKLIKAIEGSQG 1002
            ::.:|.:|||...|
Yeast  1465 MRSRLCQAIEEGAG 1478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 107/404 (26%)
HECTc 674..1003 CDD:214523 101/380 (27%)
UFD4NP_012915.3 HUL4 581..1482 CDD:227354 107/404 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.