DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and HUL5

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_011374.1 Gene:HUL5 / 852736 SGDID:S000003109 Length:910 Species:Saccharomyces cerevisiae


Alignment Length:435 Identity:126/435 - (28%)
Similarity:203/435 - (46%) Gaps:57/435 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 WEERVHTDGRVFYIDHNTRTTQWEDPRLS---NPNIAGQAVPYSRDYKQKYEYFKSHIRKPTNVP 647
            :||||.    :||:     ....:..|||   :.|:.....|::          .:.:||.:.: 
Yeast   513 FEERVD----LFYM-----FIALDKKRLSLDDDHNLINMFTPWA----------STGMRKQSAI- 557

  Fly   648 NKFEIRIRRTSILEDSYRIISSVTKTDLLKTKLWV----EFEGETGLDYGGLAREWFYLLSKEMF 708
                  |.|.::|||::...:|:  .:..|..|.|    ||..|.|:|.||:.:|:...:|.|.|
Yeast   558 ------ISRDNVLEDAFNAFNSI--GERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGF 614

  Fly   709 -NPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMML 772
             :|.:.||..:  |.|.|.   .|.:.:...|.|..|:|::.|..:|...|:|..|...|.|.:|
Yeast   615 KDPKHELFRTN--DRYELY---PSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLL 674

  Fly   773 QKP----IDLKDMESVDTEYYNSLMWI---KENDPRILELTFCLDEDVFGQKSQHELKPGGANID 830
            ...    ....|:.|.|:..||:|:.:   ..::.:.|:|||.:||.....|.. :|.|.|:...
Yeast   675 NYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAKVV-DLIPNGSKTY 738

  Fly   831 VTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQ-NIDVKD 894
            ||.:|...|:..|.:::...|..:.:|:|..|...||..:.:::|:..||::|:.|.: |||:.|
Yeast   739 VTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDD 803

  Fly   895 WRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTI 959
            .:.||.|.|....:..|:. ||..:..|..|.:...|:|||...:.|:.|||.|    .|: |.|
Yeast   804 LKSNTEYGGYKEEDQTIVD-FWEVLNEFKFEEKLNFLKFVTSVPQAPLQGFKAL----DPK-FGI 862

  Fly   960 EKWGTPN-NFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            ...||.. ..|.|.||.|.|.||.|.....|::||:.||.....|
Yeast   863 RNAGTEKYRLPTASTCVNLLKLPDYRNKTILREKLLYAINSGARF 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736 6/26 (23%)
HECTc 650..1003 CDD:238033 112/366 (31%)
HECTc 674..1003 CDD:214523 106/342 (31%)
HUL5NP_011374.1 HUL4 35..910 CDD:227354 126/435 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.