DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and UPL4

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_195908.1 Gene:UPL4 / 831758 AraportID:AT5G02880 Length:1502 Species:Arabidopsis thaliana


Alignment Length:447 Identity:108/447 - (24%)
Similarity:194/447 - (43%) Gaps:100/447 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 LSNPNIAGQAVPYSRDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLK 677
            ||:.|:.|:|.|.:                 .::|.| :....|.:|||.:.:::......   |
plant  1094 LSSSNVHGEARPVT-----------------GSLPRK-KFLACRENILESAAKMMELYGNQ---K 1137

  Fly   678 TKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLF------------EYSAMDNYTLQINNG 730
            ..:.||:..|.|...|. ..|::.|:|:...||..|::            |:|.:      :.:.
plant  1138 VVIEVEYSEEVGTGLGP-TLEFYTLVSRAFQNPDLGMWRNDCSFIVGKPVEHSGV------LASS 1195

  Fly   731 SGL---------CNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDT 786
            |||         ...:.|..|..:|.:...|:..|::||....:.|||::|.:.:...|:..||.
plant  1196 SGLFPRPWSGTSTTSDVLQKFVLLGTVVAKALQDGRVLDLPLSKAFYKLILGQELSSFDIHFVDP 1260

  Fly   787 EYYNSLMWIK--------------ENDPRILELTF--------CLDEDVFGQKSQHELKPGGANI 829
            |...:|:.::              ::.....:|:|        ||:..:.|. :.::|.|..||.
plant  1261 ELCKTLVELQALVRRKKLFAEAHGDSGAAKCDLSFHGTKIEDLCLEFALPGY-TDYDLAPYSAND 1324

  Fly   830 DVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKD 894
            .|..:|.:||||.::.......:::|:.:|..||..:..:..::||:|.|||.::||        
plant  1325 MVNLDNLEEYIKGIVNATVCNGIQKQVEAFRSGFNQVFSIEHLRIFNEEELETMLCG-------- 1381

  Fly   895 WRENTLYKGDYHMNHI-----------IIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKEL 948
              |..|:..:..::||           .:::..:.:..|..|.:...||||||:.|:|..|...|
plant  1382 --ECDLFSMNEVLDHIKFDHGYTSSSPPVEYLLQILHEFDREQQRAFLQFVTGSPRLPHGGLASL 1444

  Fly   949 YGSNGPQMFTIEKWGTPN---NFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQG 1002
                .|::..:.|.|:.:   :.|...||.|.|.||||....::|:|||.||...||
plant  1445 ----SPKLTIVRKHGSDSSDTDLPSVMTCANYLKLPPYSSKEKMKEKLIYAITEGQG 1497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736 108/447 (24%)
HECTc 650..1003 CDD:238033 100/410 (24%)
HECTc 674..1003 CDD:214523 96/386 (25%)
UPL4NP_195908.1 ARM 156..264 CDD:237987
armadillo repeat 156..181 CDD:293788
armadillo repeat 189..226 CDD:293788
armadillo repeat 230..263 CDD:293788
HEAT repeat 277..303 CDD:293787
HECTc 1114..1500 CDD:238033 100/409 (24%)
HECTc 1136..1497 CDD:214523 94/385 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.