DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and WWC2

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_011530571.1 Gene:WWC2 / 80014 HGNCID:24148 Length:1216 Species:Homo sapiens


Alignment Length:417 Identity:99/417 - (23%)
Similarity:157/417 - (37%) Gaps:119/417 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 MEQNTGGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLG-PLP 583
            |.:..|..:.|||..|......:|:.|:|||.:|||:|||||:....|:     ...|.:| .||
Human     1 MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRLTKPL-----SFADCVGDELP 60

  Fly   584 EGWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRDY---------KQKYEYFKSH 639
            .|||........|:||||..:|||.||||   ....|:.....:||         .||..|   |
Human    61 WGWEAGFDPQIGVYYIDHINKTTQIEDPR---KQWRGEQEKMLKDYLSVAQDALRTQKELY---H 119

  Fly   640 IRKPTNVPNKFEIRIRRTSILEDSYRI-----------ISSVTK--TDLLKTKLWVEFEGETGLD 691
            :::     .:..:.:.....|.|:|:.           .||.||  .|:||.::     ..|.|.
Human   120 VKE-----QRLALALDEYVRLNDAYKEKSSSHTSLFSGSSSSTKYDPDILKAEI-----STTRLR 174

  Fly   692 YGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHG 756
            ...|.|| ...:.:|:.....|......:|.                    |..|..:|..:...
Human   175 VKKLKRE-LSQMKQELLYKEQGFETLQQIDK--------------------KMSGGQSGYELSEA 218

  Fly   757 K--LLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRILELTFCLDEDVFGQKSQ 819
            |  |.:...||        |.|...:.|..|  ...||..::|.        |.||:::  .:|:
Human   219 KAILTELKSIR--------KAISSGEKEKQD--LMQSLAKLQER--------FHLDQNI--GRSE 263

  Fly   820 HELK---------------PGGANIDVTNE-------NKDEYIKLVIEW----RFVARVKEQMSS 858
            .:|:               ..|:...::.:       |..|.::|.:::    |.:|.:|.::|.
Human   264 PDLRCSPVNSHLCLSRQTLDAGSQTSISGDIGVRSRSNLAEKVRLSLQYEEAKRSMANLKIELSK 328

  Fly   859 FLD-----GFGSIIPLNLIKIFDEHEL 880
             ||     |...|....|:.|.::.||
Human   329 -LDSEAWPGALDIEKEKLMLINEKEEL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 13/28 (46%)
WW 581..613 CDD:197736 16/31 (52%)
HECTc 650..1003 CDD:238033 53/277 (19%)
HECTc 674..1003 CDD:214523 46/240 (19%)
WWC2XP_011530571.1 WW 12..41 CDD:278809 13/28 (46%)
WW 59..88 CDD:278809 14/28 (50%)
DUF342 <283..385 CDD:302792 16/73 (22%)
YlqD 351..>428 CDD:287979 2/4 (50%)
C2_Kibra 700..823 CDD:176062
vWFA <1058..>1153 CDD:294047
Phage_Nu1 <1117..1192 CDD:294991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.