DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and HECTD3

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_078878.3 Gene:HECTD3 / 79654 HGNCID:26117 Length:861 Species:Homo sapiens


Alignment Length:339 Identity:92/339 - (27%)
Similarity:154/339 - (45%) Gaps:49/339 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 WVE--FEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDN--------YTLQINNGSGLCN 735
            |.|  |..|..:|.||..|:....:|:|:..        |:.|.        .|....||:|...
Human   527 WWECKFIAEGIIDQGGGFRDSLADMSEELCP--------SSADTPVPLPFFVRTANQGNGTGEAR 583

  Fly   736 EEHL--------SYFKFIGRIAGMAVYHGKLLDAFFIRPF-YKMMLQKPID-LKDMESVDTEYYN 790
            :.::        :.:::||::.|.|: .||......:..| :|.:..:.:. .||..:||:....
Human   584 DMYVPNPSCRDFAKYEWIGQLMGAAL-RGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVK 647

  Fly   791 SLMWIKENDPRIL------ELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFV 849
            .|..::..|....      ||||   ..|...:...||.||||.|.|...::..:|:||.:.| :
Human   648 LLEVMEGMDKETFEFKFGKELTF---TTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKAR-L 708

  Fly   850 ARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQW 914
            ...|||:::...|...::|..::.:....|||..:||...:.|...|:.|.:: |:..:...:|:
Human   709 EESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFE-DFEPSDSRVQY 772

  Fly   915 FWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLD 979
            ||.|:.:|:||.|||.|:||||.||:|...:  :|    |.....|   |.:..|.:.||.:.|.
Human   773 FWEALNNFTNEDRSRFLRFVTGRSRLPARIY--IY----PDKLGYE---TTDALPESSTCSSTLF 828

  Fly   980 LPPYEGYLQLKDKL 993
            ||.|......::||
Human   829 LPHYASAKVCEEKL 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 92/339 (27%)
HECTc 674..1003 CDD:214523 92/339 (27%)
HECTD3NP_078878.3 APC10-HECTD3 238..371 CDD:176487
HECT 579..845 CDD:366212 77/279 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.