DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Herc3

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001348895.1 Gene:Herc3 / 73998 MGIID:1921248 Length:1050 Species:Mus musculus


Alignment Length:456 Identity:128/456 - (28%)
Similarity:211/456 - (46%) Gaps:55/456 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 HTDGRVFYIDHNTRTTQWEDPRL----------SNPNIAGQAV-----PYSRDYKQKYEYFKSHI 640
            |.:...|||...:.....::..|          :.|:|...||     |:..|.:.|.:..::..
Mouse   606 HVEYDKFYIPEISSLVDIQEDYLMWFLHQSGMKARPSIMQDAVTLCSYPFIFDAQAKTKMLQTDA 670

  Fly   641 R-------KPTNVPNKF---------------EIRIRRTSILEDSYRIISSVTKTDLLKTKLWVE 683
            .       ...|:.|.|               .:.:||..::.|:.|.:|..:..| ||..|.|.
Mouse   671 ELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNHLVGDALRELSIHSDID-LKKPLKVI 734

  Fly   684 FEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRI 748
            |:||.|:|.||:.:|:|.||.||:.||.||:|.| ..|:..|..   |..|..|| ::|..||..
Mouse   735 FDGEEGVDAGGVTKEFFLLLLKELLNPIYGMFTY-YQDSNLLWF---SDTCFVEH-NWFHLIGIT 794

  Fly   749 AGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRILELTFCLD--- 810
            .|:|:|:..::|..|....||.:|.....|:|::.:......||..:.:.....:|.||||:   
Mouse   795 CGLAIYNSTVVDLHFPLALYKKLLNVKPSLEDLKELSPTEGRSLQELLDYPGEDIEETFCLNFTV 859

  Fly   811 -EDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKI 874
             .:.:|...|.:|.|||..:.|..:|:.|::...:.:.|...|.|..::|..||..:....::::
Mouse   860 CRESYGVIEQKKLIPGGDRVAVCKDNRQEFVDAYVNYIFQISVHEWYTAFSSGFLKVCGGKVLEL 924

  Fly   875 FDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSR 939
            |...||..:|.|..|.|.::..|..:|:|||...|..::.||.....|..|.:.:.|.|:||:.|
Mouse   925 FQPAELRAMMVGNSNYDWEELEETAVYRGDYSSTHPTVKLFWETFHEFPLEKKKKFLLFLTGSDR 989

  Fly   940 VPMNGFKELYGSNGPQMFTIEKWGTPNNF-PRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            :|:.|...|       ...|:...|...: |.||||:|.||||.|.....:|.:|.:|::..:||
Mouse   990 IPIYGMASL-------QIIIQSTATGEEYLPVAHTCYNLLDLPKYSSKEIMKARLTQALDNYEGF 1047

  Fly  1004 A 1004
            :
Mouse  1048 S 1048

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736 4/21 (19%)
HECTc 650..1003 CDD:238033 112/372 (30%)
HECTc 674..1003 CDD:214523 106/333 (32%)
Herc3NP_001348895.1 ATS1 2..331 CDD:227511
RCC1 313..377 CDD:366085
HECTc 702..1048 CDD:238033 112/358 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.