DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and hace1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_012818577.2 Gene:hace1 / 734146 XenbaseID:XB-GENE-5757512 Length:1012 Species:Xenopus tropicalis


Alignment Length:392 Identity:168/392 - (42%)
Similarity:234/392 - (59%) Gaps:20/392 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 SRDYKQKYEYFKSH----------IRKPTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLKTKL 680
            ::.:|::.|:|..|          :.:|.| .|.. :.:.|.||...|..::.. :..:.||..:
 Frog   624 AQPFKERCEWFYEHLLAGQPDSDMVHRPVN-ENDI-LLVHRDSIFRSSCEVVFK-SNCEKLKQGI 685

  Fly   681 WVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFI 745
            .|.|.||.|:.. |:.||||.:||.|:.||.|.||..|| |..|.|.|:.|.: |.:||:||:|.
 Frog   686 AVRFHGEEGMGQ-GVVREWFDILSSEIINPDYALFTQSA-DGTTFQPNSNSSV-NPDHLNYFRFA 747

  Fly   746 GRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKEND--PRILELTFC 808
            |.|.|:|:||.:|::.:|.|.|||.:|..|::.:|:.|:|.||..:|.||.:||  ...|||||.
 Frog   748 GEILGLALYHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFS 812

  Fly   809 LDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIK 873
            ::.||||...:..||||||:|.||.|||.||::||.|.|....::.|::.||.||...||.:||:
 Frog   813 VETDVFGAMEEVPLKPGGASILVTQENKAEYVQLVTELRMTRAIQPQINGFLQGFHMFIPPSLIQ 877

  Fly   874 IFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTS 938
            :|||:|||||:.|:..|||.||.:||.|...|..:..:|||||..|...:.|.|..|||||||:|
 Frog   878 LFDEYELELLLSGMPEIDVNDWMKNTEYTSGYERDDQVIQWFWEVVQELTQEERVLLLQFVTGSS 942

  Fly   939 RVPMNGFKELYGSNGPQMFTIEKWG-TPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIE-GSQ 1001
            |||..||..:.|.:|.|.|||.... |||..|.:.||.|.|.||.|.....|||:|:.|:. ||.
 Frog   943 RVPHGGFAYIMGGSGLQNFTIAAVAYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSY 1007

  Fly  1002 GF 1003
            |:
 Frog  1008 GY 1009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 160/356 (45%)
HECTc 674..1003 CDD:214523 156/332 (47%)
hace1XP_012818577.2 PLN03192 <19..289 CDD:215625
ANK repeat 134..163 CDD:293786
ANKYR <160..288 CDD:223738
ANK repeat 165..196 CDD:293786
ANK repeat 198..229 CDD:293786
ANK repeat 231..262 CDD:293786
ANK repeat 264..289 CDD:293786
HECTc 657..1006 CDD:238033 158/353 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000080
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.