DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Ube3b

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001137366.1 Gene:Ube3b / 687633 RGDID:1583074 Length:1070 Species:Rattus norvegicus


Alignment Length:427 Identity:135/427 - (31%)
Similarity:210/427 - (49%) Gaps:51/427 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 VPYSRDYKQKYEYFKSHIRK----------PTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLK 677
            :|:...:|.:...|::.:.|          .:..|:...|.|||:.:|||.|..:..:.: ..:|
  Rat   646 IPHVVPHKNRVLLFRNMVIKEKEKLGLVETSSASPHVTHITIRRSRMLEDGYEQLRQLPQ-HAMK 709

  Fly   678 TKLWVEFEG-----ETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEE 737
            ..:.|:|..     |.|:|..|:.:|:...:.|.:|:|...||:.::.|.....  :.:...:|.
  Rat   710 GAIRVKFVSDLGVDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYP--SPTSYIHEN 772

  Fly   738 HLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMML-------QKPIDLKDMESVDTEYYNSLMWI 795
            :|..|:|:|::.|.|||.|.::|..|...|...||       ...:|  ::.|:|:|:|.:|..|
  Rat   773 YLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQMLGHHHSVFYSSVD--ELPSLDSEFYKNLTSI 835

  Fly   796 KENDPRI--LELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSS 858
            |..|..:  |.||...||||.||...|||.|||..|.||:|||..||.|:..:|...::|.|.::
  Rat   836 KRYDGDVADLGLTLSYDEDVMGQLVCHELVPGGKTIPVTDENKISYIHLMAHFRMHTQIKNQTAA 900

  Fly   859 FLDGFGSIIPLNLIKIFDEHELELLMCGIQ-NIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLS- 921
            .:.||.|||....|::|...||:.|:.|.. .||::|.:::|:|.|.:|.:|.:|.|.|..:.| 
  Rat   901 LISGFRSIIKPEWIRMFSTPELQRLISGDNAEIDLEDLKKHTVYYGGFHGSHRVIVWLWDILASD 965

  Fly   922 FSNEMRSRLLQFVTGTSRVPMNGFKEL--------------------YGSNGPQMFTIEKWGTPN 966
            |:...|:..|:|||..||.|:.||..|                    .||.....|||.|.....
  Rat   966 FTPGERAMFLKFVTSCSRPPLLGFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKREPGG 1030

  Fly   967 NFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            ..|.:.||||.|.||.|.....|::||..||..:.||
  Rat  1031 RLPTSSTCFNLLKLPNYSKKSVLREKLRYAISMNTGF 1067

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 128/388 (33%)
HECTc 674..1003 CDD:214523 120/364 (33%)
Ube3bNP_001137366.1 HECTc 684..1068 CDD:238033 130/389 (33%)
HECTc 709..1067 CDD:214523 120/361 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.