DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and hace1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_701235.5 Gene:hace1 / 572430 ZFINID:ZDB-GENE-110411-52 Length:905 Species:Danio rerio


Alignment Length:400 Identity:167/400 - (41%)
Similarity:236/400 - (59%) Gaps:26/400 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 IAGQAVPYSRDYKQKYEYFKSH----------IRKPTNVPNKFEIRIRRTSILEDSYRIISSVTK 672
            |.||      .:|.:.|:|..|          :.:|.| .|.. :.:.|.|:...|..::|. :.
Zfish   515 IKGQ------PFKDRCEWFYEHLLAGQPDSDMVHRPVN-ENDI-LLVHRDSLFRSSCEVVSK-SS 570

  Fly   673 TDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEE 737
            .:.||..:.|.|.||.|:.. |:.||||.:||.|:.||.|.||..|| |..|.|.|:.|.: |.:
Zfish   571 NEKLKQGIAVRFHGEEGMGQ-GVVREWFDILSNEIINPDYALFTQSA-DGTTFQPNSNSSV-NPD 632

  Fly   738 HLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKEND--P 800
            ||:||:|.|:|.|:|:||.:|::.:|.|.|||.:|..|:..:|:.|:|.||..:|.||.:||  .
Zfish   633 HLNYFRFAGQILGLALYHRQLVNIYFTRSFYKHILGIPVSYQDVSSIDPEYAKNLQWILDNDISD 697

  Fly   801 RILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGS 865
            ..|||||.::.||||...:..|||||..|.||.:||:||::||.|.|....::.|:::||.||.:
Zfish   698 LGLELTFSVETDVFGTMEEVPLKPGGTTIQVTQDNKEEYVQLVTELRMTRAIQPQINAFLQGFHT 762

  Fly   866 IIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRL 930
            .||.:||::|||:|||||:.|:..|||.||:.||.|...|.:...:|||||..|.:.:.|.|..|
Zfish   763 FIPPSLIQLFDEYELELLLSGMPEIDVMDWKRNTEYTSGYDLQEPVIQWFWEVVENLTQEERVLL 827

  Fly   931 LQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWG-TPNNFPRAHTCFNRLDLPPYEGYLQLKDKLI 994
            ||||||:||||..||..|.|.:|.|.||:.... |.|..|.:.||.|.|.||.|.....|:|:|:
Zfish   828 LQFVTGSSRVPHGGFAFLMGGSGLQKFTVAAVPYTSNLLPTSSTCINMLKLPEYPSKDVLRDRLL 892

  Fly   995 KAIE-GSQGF 1003
            .|:. ||.|:
Zfish   893 VALHCGSYGY 902

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 156/356 (44%)
HECTc 674..1003 CDD:214523 152/332 (46%)
hace1XP_701235.5 ANK repeat 71..100 CDD:293786
ANK 71..98 CDD:197603
Ank_2 74..199 CDD:289560
ANK 97..222 CDD:238125
ANK repeat 102..133 CDD:293786
ANK repeat 135..166 CDD:293786
Ank_2 140..227 CDD:289560
ANK repeat 168..199 CDD:293786
ANK repeat 201..226 CDD:293786
Ank_4 204..254 CDD:290365
ANK repeat 233..261 CDD:293786
HECTc 550..899 CDD:238033 154/353 (44%)
HECTc 575..898 CDD:214523 149/325 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000080
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.