DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and plekha5

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_021330752.1 Gene:plekha5 / 567300 ZFINID:ZDB-GENE-041210-25 Length:1398 Species:Danio rerio


Alignment Length:309 Identity:68/309 - (22%)
Similarity:109/309 - (35%) Gaps:90/309 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 LPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLGPLPEGWEERVHTDGR 595
            ||..||..|..:||.|||:..::.|||:.|..|.|  :....|:..|    ||.||||....:|.
Zfish    13 LPSSWSYGVTRDGRVFFINEEAKSTTWLHPVTGEA--VITGHRKTPD----LPTGWEEGYTFEGA 71

  Fly   596 VFYIDHNTRTTQWEDP---------------------RLSNPNIAGQAV----------PYS--- 626
            ..:|:||.|....:.|                     .|.:|.::..|.          |.|   
Zfish    72 RCFINHNERKVTCKHPVSGVPSQDNCIFVVNEHLNCGNLVHPVLSRPATKAPEAEKKERPTSTMS 136

  Fly   627 --RDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETG 689
              .:|....:| .:|...||..|::...::.......:|   |.......::|.. |:..:..||
Zfish   137 EASNYTGGSDY-TTHPSSPTTRPSRSSKKVHNFGKRSNS---IKRNPNAPVIKNG-WLHKQDSTG 196

  Fly   690 LDYGGLAREWFYLLSKEMFNPYY------GLFEYSAMDNYTLQINNGSGLCNEEHLS-YFKFIGR 747
            :..  ..:.||.|....:|  ||      |:.....:.::.:     |.|..::|:: .:.|...
Zfish   197 MKM--WKKRWFVLSDMCLF--YYRDEKEEGILGSILLPSFHI-----SMLSVDDHITRKYAFKAT 252

  Fly   748 IAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIK 796
            ...|..|:.....|                 |||||          |:|
Zfish   253 HPNMRTYYFSTDTA-----------------KDMES----------WMK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 13/28 (46%)
WW 581..613 CDD:197736 12/52 (23%)
HECTc 650..1003 CDD:238033 27/154 (18%)
HECTc 674..1003 CDD:214523 25/130 (19%)
plekha5XP_021330752.1 WW 13..42 CDD:306827 13/28 (46%)
WW 58..87 CDD:306827 11/28 (39%)
PH_PEPP1_2_3 177..280 CDD:270068 25/135 (19%)
SMC_N 822..>983 CDD:330553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.