DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and wwc3

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001103940.1 Gene:wwc3 / 566492 ZFINID:ZDB-GENE-070209-229 Length:1148 Species:Danio rerio


Alignment Length:447 Identity:102/447 - (22%)
Similarity:159/447 - (35%) Gaps:146/447 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 EEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLG-PLPEGWEERVH 591
            |.||||.|......:||.|:|||.:|:|:|||||:....|:     ...|.:| .||.|||....
Zfish    14 ELPLPPGWEEARDYDGRVFYIDHNTRQTSWIDPRDRITKPL-----TFADCVGDELPLGWEVVYD 73

  Fly   592 TDGRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRDYKQKYE-YFKSHI---RKPTNVPNK-FE 651
            ....|:||||..:|||.|:||              ..::|:.| ..|.::   ::..|...: ::
Zfish    74 QQVGVYYIDHINKTTQIENPR--------------TQWRQEQERMLKEYLVVAQEALNAKKEMYQ 124

  Fly   652 IRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFE 716
            |:.:|..:.:...::.:.:|:.|  ...:.....|.:               |...::|      
Zfish   125 IKQQRLELAQQEMQLFNQLTQDD--NRSITSSHSGSS---------------SNAKYDP------ 166

  Fly   717 YSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMM----LQKPID 777
                |....:|     .|..|.||..|     ..:|....:|.        ||.|    ||: ||
Zfish   167 ----DQIKAEI-----ACRRERLSRLK-----QELAQMRQELQ--------YKEMGVETLQE-ID 208

  Fly   778 LKDMESVDTEY--------YNSLMWI--------KENDPRI-----LELTFCLD--------EDV 813
            .| |.|..|.|        ::.|..|        ||....|     |.|.||..        |.:
Zfish   209 RK-MSSSQTNYKLDEAQAIFSELRSIKKAISTGEKERQDLIQSLAKLTLNFCDSINEVTNNAESL 272

  Fly   814 FGQKSQHELKPGGANIDVTNENKDEYIKLV-----IEWRFVARVKEQMSSFLDGFGSIIPLNLIK 873
            ....|..:....|...|:..|...:...|:     :.|:: ...|::|||.              
Zfish   273 ADSCSVQQYTDAGCQTDLMGEFGSQESSLLADRVKLSWQY-EEAKKKMSSI-------------- 322

  Fly   874 IFDEHELELL----MCGIQNIDVKDW-------------RENTLYKGDYHMNHIIIQ 913
               :|:|..|    ..|....| :||             :|.||.....|.:..::|
Zfish   323 ---QHQLAQLDSESWSGRAEAD-RDWDCLQLLREKETLLQELTLLSQQQHSSDTLLQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 14/28 (50%)
WW 581..613 CDD:197736 15/31 (48%)
HECTc 650..1003 CDD:238033 60/319 (19%)
HECTc 674..1003 CDD:214523 57/295 (19%)
wwc3NP_001103940.1 WW 17..46 CDD:278809 14/28 (50%)
WW 64..93 CDD:278809 14/28 (50%)
C2_Kibra 677..800 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.