DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and LOC564220

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_017212193.1 Gene:LOC564220 / 564220 -ID:- Length:1406 Species:Danio rerio


Alignment Length:231 Identity:62/231 - (26%)
Similarity:89/231 - (38%) Gaps:60/231 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 NRILLDVDHRQQEPQHRGQRHQQQHRPSNEDTDHTDSHNP---SDISAP----STRRNSEEDNAA 516
            :::|.:.|.        |...|::...|....|..||..|   .|...|    .....:||...|
Zfish   203 DQVLFEEDF--------GPEVQRKRTTSVSKMDRKDSVVPEEEEDEERPQLPNGIPERTEEWRKA 259

  Fly   517 VPPMEQNTGG------------------EEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNG 563
            ||...|::|.                  ..||||..|.|.....|..:||||.::.|||:|||..
Zfish   260 VPSYTQSSGAGGSGTLEIRTWSSLPRDDSLEPLPYNWEMAYTETGMVYFIDHNTKSTTWLDPRLV 324

  Fly   564 RASPMPNQTRRVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDP----------------- 611
            :.:..|   .:.||  |.||.||||........:|:||..:.||:|:|                 
Zfish   325 KKAKPP---EKCED--GELPYGWEEIDDPQYGTYYVDHINQRTQFENPVVEAKRKLGLDTAVATQ 384

  Fly   612 ---RLSNPNIAGQAVP-YSRDYKQ-KYEYFKSHIRK 642
               |.:.|.......| ::||..| |.|.:.:.:||
Zfish   385 TQQRAAPPPGGAAGTPGFTRDPTQLKGELYHTALRK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 12/28 (43%)
WW 581..613 CDD:197736 13/51 (25%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
LOC564220XP_017212193.1 PDZ_signaling 15..98 CDD:238492
NK 120..>198 CDD:327404
WW 291..323 CDD:197736 15/31 (48%)
WW 338..367 CDD:306827 12/28 (43%)
PDZ 412..498 CDD:214570 3/9 (33%)
PDZ 589..664 CDD:214570
PDZ_signaling 733..817 CDD:238492
PDZ_signaling 857..946 CDD:238492
PDZ_signaling 1011..1084 CDD:238492
Neuromodulin_N <1182..>1365 CDD:331332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.