DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and magi2a

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001314782.1 Gene:magi2a / 564112 ZFINID:ZDB-GENE-050810-4 Length:1503 Species:Danio rerio


Alignment Length:256 Identity:60/256 - (23%)
Similarity:108/256 - (42%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 QQQQQQNRILLDVDHRQQEPQHRGQRHQQQHRP---------SNEDTDHTDSHN----------P 498
            |.::::|:.:.:::....||    ...:::.||         :.|.::|.|...          |
Zfish   216 QGKRRRNKSVSNMEKAGIEP----PEEEEEERPVINGNGVAITPESSEHEDKSTDASGEMATTCP 276

  Fly   499 SDISAPSTRRNSEEDNAAVPPMEQNTGGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNG 563
            |:.|..:.:.::|...:...|.|.:..|   |||..|.|.....|..:||||.::.|:|:|||..
Zfish   277 SETSTDAPKEDTEPPKSPPKPDENDELG---PLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLA 338

  Fly   564 RASPMPNQTRRVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLS-------NPNIAGQ 621
            :.:..|.:.:..|     ||.|||:........:|:||..|.||:|:|.|.       ...:..|
Zfish   339 KKAKPPEECKENE-----LPYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRRLQHQQQMQSQ 398

  Fly   622 ---AVPYSRDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLKTK 679
               ::|....|::|..:    .|.||.:...|.....:.|.:...:.||......:.|:.|
Zfish   399 GLSSLPLPAVYREKPLF----TRDPTQLKGSFLSTPLQKSNMGFGFTIIGGDEPDEFLQVK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 11/28 (39%)
WW 581..613 CDD:197736 13/31 (42%)
HECTc 650..1003 CDD:238033 6/30 (20%)
HECTc 674..1003 CDD:214523 2/6 (33%)
magi2aNP_001314782.1 PDZ_signaling 25..100 CDD:238492
NK 122..286 CDD:302627 12/73 (16%)
WW 307..337 CDD:238122 12/29 (41%)
WW 352..381 CDD:278809 12/28 (43%)
PDZ 431..511 CDD:214570 5/25 (20%)
PDZ 595..676 CDD:214570
PDZ 762..856 CDD:214570
PDZ_signaling 920..1007 CDD:238492
PDZ_signaling 1182..1262 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.