DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and hectd2

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_009304826.1 Gene:hectd2 / 562999 ZFINID:ZDB-GENE-100405-3 Length:756 Species:Danio rerio


Alignment Length:381 Identity:123/381 - (32%)
Similarity:188/381 - (49%) Gaps:55/381 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 IRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFE 716
            |::||..::.||...:|  .|...||.||.|.|.||.|||.|||.:|||.||.:::|:..||:|.
Zfish   399 IKVRRLQLVSDSLDELS--RKRADLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHTDYGMFT 461

  Fly   717 YS-----------AMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKM 770
            |.           ..|||                |.|:.:|.:.|:|||:...||..|....||.
Zfish   462 YVKESQCYWFSSWKCDNY----------------SEFRLVGALMGLAVYNSITLDIRFPPCVYKK 510

  Fly   771 MLQKPI--------------DLKDMESVDTEYYNSLMWIKENDPRILE---LTFCLDEDVFGQKS 818
            :|..||              .|.|::.:..:..:.|..:...:..:.|   .||.:.::..|...
Zfish   511 LLTPPIVPCDLDTPVGMATLTLDDLQQIMPDLAHGLGELLSYEGNVEEDFYTTFQVFQEELGVVK 575

  Fly   819 QHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELL 883
            .:.|||||..|.|||.|:.||::|.|::.....:..|.::|..||.|:...|.:.:....|:|:|
Zfish   576 AYNLKPGGDKIPVTNLNRKEYVQLYIDFLLNKSIYRQFAAFYHGFHSVCASNALMLLRPEEVEIL 640

  Fly   884 MCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKEL 948
            :||..|:|:...:....|:| |......|:.||..||:|..|::.:||.|.||:.|||:.|..:|
Zfish   641 VCGSPNLDMGSLQRVVQYEG-YSKTDPTIRAFWDVVLAFPLELQKKLLHFTTGSDRVPVGGMADL 704

  Fly   949 YGSNGPQMFTIEKWGTPNNF-PRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
                   .|.|.|.....:: |.:|||||::.||||:...:|:.||..||..::||
Zfish   705 -------NFKISKIDVSTDWLPVSHTCFNQICLPPYKSKKELRQKLTIAISNAEGF 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 121/379 (32%)
HECTc 674..1003 CDD:214523 114/357 (32%)
hectd2XP_009304826.1 HECTc 397..754 CDD:238033 123/381 (32%)
HECTc 420..753 CDD:214523 114/356 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.