DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and herc5.1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_017211386.1 Gene:herc5.1 / 559981 ZFINID:ZDB-GENE-090311-56 Length:884 Species:Danio rerio


Alignment Length:416 Identity:108/416 - (25%)
Similarity:182/416 - (43%) Gaps:55/416 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 NIAGQ--AVPYSRD-YKQKYEYFKSHIRKPTNVP------------------NKFEIRIRRTSIL 660
            |:.||  |:...|: |::.:       ||.|:.|                  .:||:.:|||::|
Zfish   492 NLTGQIHALEAQRNAYEETF-------RKLTSFPCIFNLEAKCSYMRNRVWKGRFELTVRRTALL 549

  Fly   661 EDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYT- 724
            ||...:::..|:..|....|.:.|............|::|..:.||:.:|...||.|:  ||.| 
Zfish   550 EDCLCLLNPGTQQHLRDKWLSILFTENVSKRTDVHKRDFFLNVFKELCDPASQLFMYN--DNETM 612

  Fly   725 ------LQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMES 783
                  |.:         |...||.| |.:.|:|..:..:::..|....:|.:|.....|:|...
Zfish   613 IWFPAKLTV---------EKKKYFLF-GILCGLAFNNSSVVNLPFPLALFKKLLNIKPSLEDFIE 667

  Fly   784 VDTEYYNSLMWIKENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRF 848
            .:..:..||.:|.|....:||.: .|...:....|:.:|.|......:|..|:.:::...::..|
Zfish   668 FNPVHGRSLQYILEYSNDVLEES-SLPLTIIWSGSELDLDPAEPEQHITTSNRTKFVDEYVDHIF 731

  Fly   849 VARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQ 913
            ...|||....|..||.......|:::|:..||..::.|.:..|....::||.|:|.::.:|.:|.
Zfish   732 NQSVKEAFEEFRRGFFRGCEKRLVEMFEPEELRGVLVGNEEYDWNILKQNTTYEGVFNADHPVII 796

  Fly   914 WFWRAVLSFS-NEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNR 977
            .||......: ||.:|.|| |:||..|||:.|...:     ....|.....|.::.|...||.:.
Zfish   797 SFWEVFDDLTPNEKKSFLL-FLTGFERVPILGMSAV-----KMRVTHLANSTEDHLPETLTCHSL 855

  Fly   978 LDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            |.||.||....|:.|:|:||...:||
Zfish   856 LQLPKYEKRETLRAKVIEAISHKRGF 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 96/360 (27%)
HECTc 674..1003 CDD:214523 87/336 (26%)
herc5.1XP_017211386.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.