DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and HERC6

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:385 Identity:99/385 - (25%)
Similarity:179/385 - (46%) Gaps:30/385 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   631 QKYEYFKSH---IRKPTNVP--NKFEIRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGL 690
            :|..|...|   ::|....|  .:|.:|:||:.:::|:.|.:|....||..|. |.|||..|...
Human   660 EKKAYMLMHETILQKKDEFPPSPRFILRVRRSRLVKDALRQLSQAEATDFCKV-LVVEFINEICP 723

  Fly   691 DYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLC-------NEEHLSYFKFIGRI 748
            :.||::.|:|:.:.:||..|.||:|.|..|           |.|       ..|...||.| |.:
Human   724 ESGGVSSEFFHCMFEEMTKPEYGMFMYPEM-----------GSCMWFPAKPKPEKKRYFLF-GML 776

  Fly   749 AGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRILELTFCLDEDV 813
            .|:::::..:.:..|....||.:|.:...|:|::.:......||..:.::....:....|:...:
Human   777 CGLSLFNLNVANLPFPLALYKKLLDQKPSLEDLKELSPRLGKSLQEVLDDAADDIGDALCIRFSI 841

  Fly   814 FGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEH 878
            ...::..:|.|.|.:|.|...||.:|:...|::.|...||.....|..||..:....:::.|...
Human   842 HWDQNDVDLIPNGISIPVDQTNKRDYVSKYIDYIFNVSVKAVYEEFQRGFYRVCEKEILRHFYPE 906

  Fly   879 ELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMN 943
            ||...:.|..:.|.|.:.:|:.|:..|..:|..||.||:|....:.:.:.:.|.|:||..|:...
Human   907 ELMTAIIGNTDYDWKQFEQNSKYEQGYQKSHPTIQLFWKAFHKLTLDEKKKFLFFLTGRDRLHAR 971

  Fly   944 GFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            |.:::     ..:|...:..:..:.|.:.||.|.|.||.|....::::.|..||..::||
Human   972 GIQKM-----EIVFRCPETFSERDHPTSITCHNILSLPKYSTMERMEEALQVAINNNRGF 1026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 92/359 (26%)
HECTc 674..1003 CDD:214523 84/335 (25%)
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274
RCC1_2 89..118 CDD:290274
RCC1 105..155 CDD:278826
RCC1 158..208 CDD:278826
RCC1 215..263 CDD:278826
RCC1_2 250..279 CDD:290274
RCC1 266..313 CDD:278826
HECTc 684..1026 CDD:238033 92/359 (26%)
HECTc 711..1026 CDD:214523 83/332 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.