DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Magix

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_061302.2 Gene:Magix / 54634 MGIID:1859644 Length:324 Species:Mus musculus


Alignment Length:304 Identity:63/304 - (20%)
Similarity:98/304 - (32%) Gaps:82/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 RSVGAKSRIKGT---------------LRIYHAFIRETREQSEPSSGNSDGEW-EHVEATNAGET 233
            |..||..|::.|               .|:.||.:.:.|.|.:.|  .:.|.| |.:..|....:
Mouse    53 RKAGATLRLRHTEGVSGLDSADIEVTDSRLPHATLVKHRPQHQRS--ETLGTWTEPLPVTQNKAS 115

  Fly   234 SAQPHPFPTGGHDAL----PAGWEERQDANGRTYYVNHTARTTQWDRPTVLNSHSSQSTDDQLAS 294
            .|...|..||.....    |||:       |.|.   ...|....|.|..::.         |..
Mouse   116 YALKVPQATGRFSVELTRGPAGF-------GLTL---SGGRNVSGDAPLTVHG---------LLK 161

  Fly   295 D--FQRRFHISVDDTE---SGRSADSISHNSIEDNNNAAGLAYTPKTAATSSAPPNTPTNNNGIL 354
            |  .||...:...|..   :|:|...::|..:.:.....|    |........|.:.   :...:
Mouse   162 DGPAQRCGRLQAGDLVLYINGQSTQGLTHAQVVERIRTGG----PHLCLVLQRPQDM---DGSRI 219

  Fly   355 AQIAMQYRAEEDQDP---TVDHTSFVYNSLRHPVAHR-------QPEISATSLQNDLRPV----- 404
            .::....:.:...||   .|:..|.:     .||.||       :|...|.::.:.:|.|     
Mouse   220 KEVGGHRKTDRSLDPRGSRVESRSTI-----SPVHHRPKTRTSPRPSPEAVAIGHVVRAVEHPTE 279

  Fly   405 ---REAPGVPD--IAITNPFTRRAAGNMAGGAGWQQE----RRR 439
               ...||.|.  :..:.....||.|...|||....|    |||
Mouse   280 DLENRIPGTPGPWLVPSEDRLSRALGVRGGGAQLALEMAAGRRR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999 8/33 (24%)
WW 248..277 CDD:278809 7/32 (22%)
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
MagixNP_061302.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PDZ 126..211 CDD:214570 18/107 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..263 9/51 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.