DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and PLEKHA5

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001243399.1 Gene:PLEKHA5 / 54477 HGNCID:30036 Length:1282 Species:Homo sapiens


Alignment Length:502 Identity:98/502 - (19%)
Similarity:180/502 - (35%) Gaps:160/502 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 LPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLGPLPEGWEERVHTDGR 595
            ||..|:..:...||.|||:..::.|||:.|..|.|  :....||...|   ||.||||....:|.
Human    12 LPRSWTYGITRGGRVFFINEEAKSTTWLHPVTGEA--VVTGHRRQSTD---LPTGWEEAYTFEGA 71

  Fly   596 VFYIDHNTRTTQWEDPRLSNPN------IAGQAVPYSRDYKQKYEYFKSHIRKPT--NVPNKFEI 652
            .:||:||.|....:.|....|:      :..:....:...::|.|...|.|.:.:  ||.:.:.:
Human    72 RYYINHNERKVTCKHPVTGQPSQDNCIFVVNEQTVATMTSEEKKERPISMINEASNYNVTSDYAV 136

  Fly   653 R----IRRTSILEDSYRIISSVTKTDLLK--------TKLWVEFEGETGLDYGGLAREWFYLLSK 705
            .    :.|||  ..|.::.:...:::.:|        .:.|:..:..||:..  ..:.||.|...
Human   137 HPMSPVGRTS--RASKKVHNFGKRSNSIKRNPNAPVVRRGWLYKQDSTGMKL--WKKRWFVLSDL 197

  Fly   706 EMFNPYY------GLFEYSAMDNYTLQINNGSGLCNEEHLS-YFKFIGRIAGMAVYH-----GK- 757
            .:|  ||      |:.....:.::.:.:     |.:|:|:: .:.|......|..|:     || 
Human   198 CLF--YYRDEKEEGILGSILLPSFQIAL-----LTSEDHINRKYAFKAAHPNMRTYYFCTDTGKE 255

  Fly   758 -------LLDAFFIR--PFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRILELTFCLDEDV 813
                   :|||..::  |..::.....:|....|:..|:..|::     .:.|:|          
Human   256 MELWMKAMLDAALVQTEPVKRITFNFRVDKITSENAPTKETNNI-----PNHRVL---------- 305

  Fly   814 FGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEH 878
                    :||     ::.|..|:                ::||               ||.::.
Human   306 --------IKP-----EIQNNQKN----------------KEMS---------------KIEEKK 326

  Fly   879 ELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRS-----------RLLQ 932
            .||....|.|    ||.::..|.|    :|.:.:.       |..:|..|           |.:.
Human   327 ALEAEKYGFQ----KDGQDRPLTK----INSVKLN-------SLPSEYESGSACPAQTVHYRPIN 376

  Fly   933 FVTGTSRVPMNGFKELYGSNGP-----------------QMFTIEKW 962
            ..:..:::......:|.|.|.|                 .|..:|:|
Human   377 LSSSENKIVNVSLADLRGGNRPNTGPLYTEADRVIQRTNSMQQLEQW 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 11/28 (39%)
WW 581..613 CDD:197736 13/31 (42%)
HECTc 650..1003 CDD:238033 61/375 (16%)
HECTc 674..1003 CDD:214523 57/347 (16%)
PLEKHA5NP_001243399.1 WW 12..41 CDD:278809 11/28 (39%)
WW 58..87 CDD:278809 12/28 (43%)
PH_PEPP1_2_3 164..267 CDD:270068 20/111 (18%)
PH 170..266 CDD:278594 19/104 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.