DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Wwc2

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001102581.1 Gene:Wwc2 / 498630 RGDID:1559427 Length:1194 Species:Rattus norvegicus


Alignment Length:390 Identity:96/390 - (24%)
Similarity:153/390 - (39%) Gaps:106/390 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 MEQNTGGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLG-PLP 583
            |.:..|..:.|||..|......:|:.|:|||.:|||:|||||:....|:     ...|.:| .||
  Rat     1 MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRLTKPL-----SFADCVGDELP 60

  Fly   584 EGWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRDY---------KQKYEYFKSH 639
            .|||.........:||||..:|||.||||   ....|:.....:||         .||..|   |
  Rat    61 WGWEAGFDPQIGAYYIDHINKTTQIEDPR---KQWRGEQEKMLKDYLSVAQDALRTQKELY---H 119

  Fly   640 IRKPTNVPNKFEIRIRRTSILEDSYRI-----------ISSVTK--TDLLKTKLWVEFEGETGLD 691
            :::     .:..:.:.....|.|:|:.           .||.||  .|:||.::     ..|.|.
  Rat   120 VKE-----QRLALALDEYVRLNDAYKEKSSSHTSLFSGSSSSTKYDPDILKAEI-----STTRLR 174

  Fly   692 YGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHG 756
            ...|.|| ...:.:|:.....| ||       |||       ..:|.:|        .|.:.|  
  Rat   175 VKKLKRE-LSQMKQELLYKQQG-FE-------TLQ-------QIDEKMS--------GGQSGY-- 213

  Fly   757 KLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRILELTFCLDEDVFGQKSQHE 821
            :|.:|..|....| .::|.|...:.|..|  ...||..::|.        |.||:::...:....
  Rat   214 ELSEAKAILTELK-SIRKAISSGEKEKQD--LMQSLAKLQER--------FHLDQNMGSSEPDLR 267

  Fly   822 LKPGGANIDVTNENKD--------------------EYIKLVIEW----RFVARVKEQMSSFLDG 862
            ..|..:::.::.:..|                    |.::|.:::    |.:|.:|.::|. |||
  Rat   268 CSPVNSHLSLSRQTLDAGSQTSISGDIGVRSRSNLAEKVRLSLQYEEAKRSMANLKIELSK-LDG 331

  Fly   863  862
              Rat   332  331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 13/28 (46%)
WW 581..613 CDD:197736 15/31 (48%)
HECTc 650..1003 CDD:238033 51/250 (20%)
HECTc 674..1003 CDD:214523 44/213 (21%)
Wwc2NP_001102581.1 WW 12..41 CDD:278809 13/28 (46%)
WW 59..88 CDD:278809 13/28 (46%)
DUF342 <283..385 CDD:302792 10/50 (20%)
YlqD 351..>420 CDD:287979
C2_Kibra 699..822 CDD:176062
Phage_Nu1 <1095..>1153 CDD:294991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.