DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and CG5087

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster


Alignment Length:432 Identity:127/432 - (29%)
Similarity:199/432 - (46%) Gaps:62/432 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 VPYSRDYKQKYEYFKSHIRKPTNV----------PNKFEIRIRRTSILEDSYRIISSVTKTDLLK 677
            :|:...::.:.:.|:..::....|          |....|.|.|..|:||.||.::: ..|..||
  Fly   655 MPHIIPHEDRVKLFRKFVQNEKAVMGLTESACASPRSALIVIHRDRIVEDGYRQLAA-QPTQALK 718

  Fly   678 TKLWVEF---EG--ETGLDYGGLAREWFYLLSKEMFNPYYGLFE-------YSAMDNYTLQINNG 730
            ..:.|.|   :|  |.|:|..|:.:|:.....|::|:|...||:       |.:..:|.      
  Fly   719 GVIRVRFINQQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFKTTSDQRLYPSPISYV------ 777

  Fly   731 SGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPID-----LKDMESVDTEYYN 790
                .:.||..|:|:||:.|.|||.|.::|..|...|...:|.:...     :.::.|:|.|.|.
  Fly   778 ----QDNHLELFEFVGRMLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYR 838

  Fly   791 SLMWIK--ENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVK 853
            ||.:||  :.|...|.|||.:|:||.|:.....|.|||....|.:.||..||..:..:....:::
  Fly   839 SLTFIKHYKQDVSDLNLTFSVDQDVMGKIVTLALHPGGKARVVNDHNKLVYIHYMAFFHMNTQIR 903

  Fly   854 EQMSSFLDGFGSIIPLNLIKIFDEHELELLMCG-IQNIDVKDWRENTLYKGDYHMNHIIIQWFWR 917
            ||..:|..||.||:....:.:|...||:.|:.| ...:|:||.:::|.|.|.:|..|.::.|.|.
  Fly   904 EQTIAFNRGFRSIVNPEWLSLFSPPELQRLISGDTSPLDLKDLQKHTHYYGGFHDTHQVVCWLWD 968

  Fly   918 AVL-SFSNEMRSRLLQFVTGTSRVPMNGFKEL--------------------YGSNGPQMFTIEK 961
            .:. .|:.|.|...|:|||..|:.|:.||..|                    .||.....|.|.|
  Fly   969 ILAKDFTEEERKLFLKFVTSCSKPPLLGFAHLEPPFSIRCVEVSDDEDTGDTIGSVIRGFFAIRK 1033

  Fly   962 WGTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            ....|..|.:.||||.|.||.|:....|:|||..|:..:.||
  Fly  1034 KDPLNRLPTSSTCFNLLKLPNYQKKSTLRDKLRYAVSSNTGF 1075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 121/393 (31%)
HECTc 674..1003 CDD:214523 112/369 (30%)
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 123/393 (31%)
HECTc 718..1075 CDD:214523 111/366 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.