DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Herc4

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:365 Identity:116/365 - (31%)
Similarity:192/365 - (52%) Gaps:33/365 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 IRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLF- 715
            :.:.|.::::||.|.:...:::| ||..|.::|.||...|.||:.:|:|.||.|::.:|.||:| 
  Fly   717 LNVTRENLVQDSLRELQHYSQSD-LKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFK 780

  Fly   716 EYSA-----MDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKP 775
            ||..     ..:.|.:..|          .|| .||.:.|:|:|:..:::..|....:|.:|.||
  Fly   781 EYEQSRLLWFADLTFETEN----------MYF-LIGVLCGLAIYNFTIINLPFPLALFKKLLGKP 834

  Fly   776 IDLKDMESVDTEYYNSLM----WIKENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENK 836
            :||.|:..:.....||:.    :..::...:.:|||.:..||||:.....|||.|..|.||.||:
  Fly   835 VDLSDLRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENR 899

  Fly   837 DEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLY 901
            .|::.|.:::.|...|:...::|..||..:....:|.||...||..::.|.::.|.:..::|..|
  Fly   900 QEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEY 964

  Fly   902 KGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPN 966
            :..|......|:|||..:...|...:...|.|:||:.|:|:.|.|.|       ..||:.  ||:
  Fly   965 REGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-------KLTIQP--TPD 1020

  Fly   967 N--FPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGFA 1004
            .  .|.||||||.||||.|:...:||.||::||:.:|||:
  Fly  1021 ERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFS 1060

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 114/362 (31%)
HECTc 674..1003 CDD:214523 110/340 (32%)
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 115/363 (32%)
HECTc 739..1059 CDD:214523 110/340 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446938
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.