DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Yap1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_006242550.1 Gene:Yap1 / 363014 RGDID:1306035 Length:491 Species:Rattus norvegicus


Alignment Length:310 Identity:74/310 - (23%)
Similarity:114/310 - (36%) Gaps:83/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 AATSSAPPNTPTNNNGILAQIAMQYRAEEDQDPTVDHTSFVYNSLRHPVAHRQPEISATSLQNDL 401
            |.|.:|||..|..:.      .:..|.:.:.|     ...::|::.:|.....|:.....|:.  
  Rat    24 AGTPAAPPAPPAGHQ------VVHVRGDSETD-----LEALFNAVMNPKTANVPQTVPMRLRK-- 75

  Fly   402 RPVREAPGVPDIAITNPFTR---RAAGNMAGGAGWQQERRRQQMQLHIQQHQQRQQQQQQNRILL 463
                    :||.....|..:   |.|...||.||....:       |::.|......|.....| 
  Rat    76 --------LPDSFFKPPEPKSHSRQASTDAGTAGALTPQ-------HVRAHSSPASLQLGAGTL- 124

  Fly   464 DVDHRQQEPQHRGQRHQQQHRPSNEDTDHTDSHNPSDISAPSTRRNSEEDNAAVPPMEQNTGGEE 528
                                         |.|...|..:|....::..:.:..:|        ::
  Rat   125 -----------------------------TASGVVSGPAATPAAQHLRQSSFEIP--------DD 152

  Fly   529 EPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNG---------RASPMPNQTRRVEDDLGPLPE 584
            .|||..|.|....:|:.:|::|..:.|||.|||..         .|||...|| .:....||||:
  Rat   153 VPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPTSASPAVPQT-LMNSASGPLPD 216

  Fly   585 GWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIA---GQAVPYSRDYKQ 631
            |||:.:..||.|:||:|..:||.|.|||| :|...   .|.:..|...||
  Rat   217 GWEQAMTQDGEVYYINHKNKTTSWLDPRL-DPRFGKAMNQRITQSAPVKQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 10/28 (36%)
WW 581..613 CDD:197736 17/31 (55%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
Yap1XP_006242550.1 WW 156..185 CDD:238122 10/28 (36%)
WW 213..245 CDD:197736 17/31 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.