DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Herc6

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_008761185.1 Gene:Herc6 / 362376 RGDID:1561739 Length:1027 Species:Rattus norvegicus


Alignment Length:405 Identity:101/405 - (24%)
Similarity:184/405 - (45%) Gaps:50/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 PYSRDYKQKYEYFK--SHIRKPTNV-----PNK-----FEIRIRRTSILEDSYRIISSVTKTDLL 676
            |:..|...|....|  |.::....|     |.|     |.:::||:.::||:.|.:......||.
  Rat   644 PFILDLPSKIILMKHDSSVKLSDEVKVAASPEKMGCPFFILKVRRSHLVEDTLRQLRQAEDFDLR 708

  Fly   677 KTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLC-----NE 736
            || |.|.|..|...:.||::.|:|:.:.:||.:|.|.:|.|.         .|||.:.     ..
  Rat   709 KT-LSVGFINEIRPEGGGVSSEFFHCIFEEMTDPKYEMFMYP---------ENGSNMWFPVNPKF 763

  Fly   737 EHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPR 801
            |...||.| |.:.|:::.:..:::..|....||.:|::...|:|::.:......:|..:...:..
  Rat   764 EKSRYFLF-GILCGLSLNNLNVINLSFPLALYKKLLEQKPSLEDLKDLSLLLGRNLQEVLNCEAG 827

  Fly   802 ILE---LTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGF 863
            ::|   :.|    .::..:...:|.|.|.::.|...||.:|:...:::.|...:|.....|..||
  Rat   828 VIEELHMYF----SIYWDQRDVDLIPDGISVPVNETNKRDYVSKCVDYIFNISIKTIYDEFHRGF 888

  Fly   864 GSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRS 928
            ..:...:.|:.|...||...:.|....|.|.:..|:.|:..|..:|..|..||:|....:.:.:.
  Rat   889 YKVCNRDSIRHFQPEELMAAIIGNPTCDWKQFENNSKYENGYSKSHPTILLFWKAFHELTLDEKK 953

  Fly   929 RLLQFVTGTSRVPMNGFKELYGSNG-----PQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQ 988
            :.|.|:||..|:.:.|.:    :.|     |::|      :..:.||:.||.:.||||.|....:
  Rat   954 KFLLFLTGCDRLHVKGLQ----NEGIRFRCPEVF------SERDNPRSLTCHSILDLPKYSTMRR 1008

  Fly   989 LKDKLIKAIEGSQGF 1003
            :|:.|..||..::||
  Rat  1009 MKEALQVAINNNKGF 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 91/365 (25%)
HECTc 674..1003 CDD:214523 85/341 (25%)
Herc6XP_008761185.1 RCC1 39..88 CDD:278826
RCC1 92..141 CDD:278826
RCC1 144..194 CDD:278826
RCC1_2 182..210 CDD:290274
RCC1_2 236..265 CDD:290274
RCC1 252..299 CDD:278826
HECTc 682..1023 CDD:238033 91/365 (25%)
HECTc 706..1023 CDD:214523 85/341 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.